Tested Applications
| Positive WB detected in | K-562 cells, 3T3-L1 cells, Daudi cells, DU 145 cells, SGC-7901 cells |
| Positive IP detected in | K-562 cells, 3T3-L1 cells |
| Positive IHC detected in | human cervical cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:8000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 27 publications below |
| IHC | See 4 publications below |
| IF | See 1 publications below |
Product Information
13179-1-AP targets STAT5A/B in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, bovine, cow |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag3846 Product name: Recombinant human STAT5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 445-794 aa of BC027036 Sequence: ESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS Predict reactive species |
| Full Name | signal transducer and activator of transcription 5A |
| Calculated Molecular Weight | 794 aa, 92 kDa |
| Observed Molecular Weight | 90-95 kDa |
| GenBank Accession Number | BC027036 |
| Gene Symbol | STAT5A |
| Gene ID (NCBI) | 6776 |
| RRID | AB_2196760 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P42229 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
STAT5A, also named as STAT5, belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5A is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of STAT5A in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of human STAT5A is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of STAT5A in cells. This antibody is a rabbit polyclonal antibody raised against 445-794 aa of human STAT5A, the homology between this segment and the corresponding segment of human STAT5B is 92%. It shows that this antibody can cross-react with STAT5B.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for STAT5A/B antibody 13179-1-AP | Download protocol |
| IP protocol for STAT5A/B antibody 13179-1-AP | Download protocol |
| WB protocol for STAT5A/B antibody 13179-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Carbohydr Polym Structural characterizations and antiaging activities of hydrolyzed low-molecular-weight polysaccharides from Polygoni Multiflori Radix Praeparata | ||
Front Immunol Exhausted signature and regulatory network of NK cells in myasthenia gravis | ||
Front Immunol Elevated levels of exogenous prolactin promote inflammation at the maternal-fetal interface via the JAK2/STAT5B signaling axis | ||
Chemosphere MEHP promotes liver fibrosis by down-regulating STAT5A in BRL-3A hepatocytes.
| ||
Endocrinology A Novel Mechanism of hPRL-G129R, A Prolactin Antagonist, Inhibits Human Breast Cancer Cell Proliferation and Migration | ||
Front Oncol In-depth analysis of the expression and functions of signal transducers and activators of transcription in human ovarian cancer |

























