• Featured Product
  • KD/KO Validated

STAT5A/B Polyclonal antibody

STAT5A/B Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 13179-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

STAT5A, MGF, STAT5

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inK-562 cells, 3T3-L1 cells, Daudi cells, DU 145 cells, SGC-7901 cells
Positive IP detected inK-562 cells, 3T3-L1 cells
Positive IHC detected inhuman cervical cancer tissue, human breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13179-1-AP targets STAT5A/B in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, bovine, cow
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3846

Product name: Recombinant human STAT5A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 445-794 aa of BC027036

Sequence: ESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAEPGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNRENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIKQVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRRPMDSLDSRLSPPAGLFTSARGSLS

Predict reactive species
Full Name signal transducer and activator of transcription 5A
Calculated Molecular Weight 794 aa, 92 kDa
Observed Molecular Weight 90-95 kDa
GenBank Accession NumberBC027036
Gene Symbol STAT5A
Gene ID (NCBI) 6776
RRIDAB_2196760
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP42229
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

STAT5A, also named as STAT5, belongs to the transcription factor STAT family. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT5A is activated by, and mediates the responses of many cell ligands, such as IL2, IL3, IL7 GM-CSF, erythropoietin, thrombopoietin, and different growth hormones. Activation of STAT5A in myeloma and lymphoma associated with a TEL/JAK2 gene fusion is independent of cell stimulus and has been shown to be essential for the tumorigenesis. The mouse counterpart of human STAT5A is found to induce the expression of BCL2L1/BCL-X(L), which suggests the antiapoptotic function of STAT5A in cells. This antibody is a rabbit polyclonal antibody raised against 445-794 aa of human STAT5A, the homology between this segment and the corresponding segment of human STAT5B is 92%. It shows that this antibody can cross-react with STAT5B.

Protocols

Product Specific Protocols
WB protocol for STAT5A/B antibody 13179-1-APDownload protocol
IHC protocol for STAT5A/B antibody 13179-1-APDownload protocol
IP protocol for STAT5A/B antibody 13179-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Carbohydr Polym

Structural characterizations and antiaging activities of hydrolyzed low-molecular-weight polysaccharides from Polygoni Multiflori Radix Praeparata

Authors - Wei Xu
humanWB

Front Immunol

Exhausted signature and regulatory network of NK cells in myasthenia gravis

Authors - Qing Zhang
humanWB

Front Immunol

Elevated levels of exogenous prolactin promote inflammation at the maternal-fetal interface via the JAK2/STAT5B signaling axis

Authors - Alycia Williams
ratWB,IF

Chemosphere

MEHP promotes liver fibrosis by down-regulating STAT5A in BRL-3A hepatocytes.

Authors - Yuezhu Zhang
  • KD Validated
humanWB

Endocrinology

A Novel Mechanism of hPRL-G129R, A Prolactin Antagonist, Inhibits Human Breast Cancer Cell Proliferation and Migration

Authors - Ruonan Li
humanWB,IHC

Front Oncol

In-depth analysis of the expression and functions of signal transducers and activators of transcription in human ovarian cancer

Authors - Xiaodi Gong
Loading...
||
New chat Able
正在加载,请稍候...