SP2 Polyclonal antibody, PBS Only

• 

  WB analysis of K-562 using 25000-1-AP (same clone as 25000-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25000-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 25000-1-AP (same clone as 25000-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25000-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 25000-1-AP (same clone as 25000-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25000-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 25000-1-AP (same clone as 25000-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 25000-1-AP (SP2 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 25000-1-PBS in a different storage buffer formulation.

SP2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 25000-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

25000-1-PBS targets SP2 in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8060

  Product name: Recombinant human SP2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 303-606 aa of BC016680

  Sequence: QQQVVQIPQQALRVVQAASATLPTVPQKPSQNFQIQAAEPTPTQVYIRTPSGEVQTVLVQDSPPATAAATSNTTCSSPASRAPHLSGTSKKHSAAILRKERPLPKIAPAGSIISLNAAQLAAAAQAMQTININGVQVQGVPVTITNTGGQQQLTVQNVSGNNLTISGLSPTQIQLQMEQALAGETQPGEKRRRMACTCPNCKDGEKRSGEQGKKKHVCHIPDCGKTFRKTSLLRAHVRLHTGERPFVCNWFFCGKRFTRSDELQRHARTHTGDKRFECAQCQKRFMRSDHLTKHYKTHLVTKNL

• Full Name: Sp2 transcription factor
• Calculated Molecular Weight: 65 kDa
• Observed Molecular Weight: 72 kDa
• GenBank Accession Number: BC016680
• Gene Symbol: SP2
• Gene ID (NCBI): 6668
• RRID: AB_2879839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02086
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

SP2 also named as Sp2 transcription factor or KIAA0048 is a 613 amino acid protein, which contains 3 C2H2-type zinc fingers and belongs to the sp1 C2H2-type zinc finger protein family. SP2 binds to box promoters elements and selectively activates mRNA synthesis from genes that contain functional recognition sites in nucleus . SP2 may regulate expression of the T-cell antigen receptor (TCR) gene.