SNX27 Polyclonal antibody

• 

  WB analysis of Jurkat using 16329-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 16329-1-AP (SNX27 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse spleen using 16329-1-AP

  mouse spleen tissue were subjected to SDS PAGE followed by western blot with 16329-1-AP (SNX27 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human cervical cancer using 16329-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 16329-1-AP (SNX27 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human cervical cancer using 16329-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 16329-1-AP (SNX27 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human tonsillitis using 16329-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16329-1-AP (SNX27 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human tonsillitis using 16329-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 16329-1-AP (SNX27 Antibody) at dilution of 1:50 (under 40x lens).

SNX27 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16329-1-AP

Publications(5)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

KIAA0488, MRT1, MY014, SNX27, Sorting nexin 27, sorting nexin family member 27

---

Tested Applications

• Positive WB detected in: Jurkat cells, mouse spleen tissue
• Positive IHC detected in: human cervical cancer tissue, human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 5 publications below

Product Information

16329-1-AP targets SNX27 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9447

  Product name: Recombinant human SNX27 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 310-528 aa of BC012184

  Sequence: MDSTTVNYFALFEVISHSFVRKLAPNEFPHKLYIQNYTSAVPGTCLTIRKWLFTTEEEILLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCEGYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEEGMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEY

• Full Name: sorting nexin family member 27
• Calculated Molecular Weight: 61 kDa, 60 kDa, 52 kDa, 28 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: BC012184
• Gene Symbol: SNX27
• Gene ID (NCBI): 81609
• RRID: AB_10888628
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96L92
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Sorting nexin 27 (SNX27), a PDZ domain-containing protein, belongs to the sorting nexin family of proteins. SNX27 promotes the recycling of internalized transmembrane proteins from endosomes to the plasma membrane by linking PDZ-dependent cargo recognition to retromer-mediated transport (PMID: 21602791; 23563491). It has been shown that SNX27 deficiency contributes to synaptic and cognitive deficits by modulating glutamate receptor recycling in Down's syndrome (PMID: 23524343). SNX27 has also been proposed to have a role in regulating β-amyloid (Aβ) generation by modulating γ-secretase activity, which is a molecular mechanism for Aβ-dependent pathogenesis in both Down's syndrome and Down's syndrome (PMID: 25437557).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	J Cell Biol; Sequence-dependent cargo recognition by SNX-BARs mediates retromer-independent transport of CI-MPR.; Authors - Boris Simonetti
human	WB	Cells; Five Inhibitory Receptors Display Distinct Vesicular Distributions in Murine T Cells; Authors - Jiahe Lu
human	WB	bioRxiv; Five inhibitory receptors display distinct vesicular distributions in T cells; Authors - Jiahe Lu
human	WB	Cell Rep; Regulation of NMDA receptor trafficking and gating by activity-dependent CaMKIIα phosphorylation of the GluN2A subunit.; Authors - Xuan Ling Hilary Yong
human,mouse	WB	Endocrinol Diabetes Metab; Diabetes is accompanied by changes in the levels of proteins involved in endosomal GLUT4 trafficking in obese human skeletal muscle; Authors - Rachel Livingstone