Tested Applications
| Positive WB detected in | mouse testis tissue, mouse brain tissue, rat heart tissue, mouse spleen tissue |
| Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
12129-1-AP targets SNAI2/SLUG in WB, IHC, IF, FC (Intra), CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2773 Product name: Recombinant human SNAI2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-268 aa of BC015895 Sequence: MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH Predict reactive species |
| Full Name | snail homolog 2 (Drosophila) |
| Calculated Molecular Weight | 268 aa, 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC015895 |
| Gene Symbol | SLUG |
| Gene ID (NCBI) | 6591 |
| RRID | AB_2191889 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O43623 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SNAI2 belongs to the Snail family of zinc finger transcription factors, which shares an evolutionarily conserved role in mesoderm formation in vertebrates and invertebrates. It tiggers epithelial-mesenchymal transitions and has a crucial role in developmental processes. Also it is a transcriptional reperssor in mediating RAF-induced expression of TJ protein, occludin(OCLN) and subsequent oncogenic transformation of epithelial cells.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for SNAI2/SLUG antibody 12129-1-AP | Download protocol |
| IHC protocol for SNAI2/SLUG antibody 12129-1-AP | Download protocol |
| WB protocol for SNAI2/SLUG antibody 12129-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The SNAI2/SLUG polyclonal antibody (Cat# 12129-1-AP) has 263 total citations. Publications span over 80 journals, including Nature Communications, Gastroenterology, Molecular Cancer, Theranostics, Cell Death & Disease, Oncogene, J Exp Clin Cancer Res, Advanced Science, Cancer Letters, and Int J Biol Sci. Research fields predominantly cover epithelial-mesenchymal transition (EMT), cancer metastasis, tumor progression, ferroptosis, autophagy, and key signaling pathways (Wnt/β-catenin, PI3K/AKT, TGF-β) across diverse cancer types.
| Species | Application | Title |
|---|---|---|
Mol Cancer The long non-coding RNA PTTG3P promotes cell growth and metastasis via up-regulating PTTG1 and activating PI3K/AKT signaling in hepatocellular carcinoma. | ||
Mol Cancer Systematic analyses reveal long non-coding RNA (PTAF)-mediated promotion of EMT and invasion-metastasis in serous ovarian cancer. | ||
Gastroenterology Cancer-associated endocrine cells participate in pancreatic carcinogenesis | ||
Drug Resist Updat Endothelial SMAD1-MCAM axis facilitates sunitinib resistance and progression of clear cell renal cell carcinoma via LAMB1-ITGB1 signaling. | ||
Nat Commun Intercellular chemerin-cmklr1 couples epicardial mechanosensing to fibroblasts in pressure overload. | ||
Clin Oral Implants Res Characterization of macrophages infiltrating peri-implantitis lesions. |
Reviews
What customers say
One reviewer (Udesh Dhawan) rated this antibody 5 stars in August 2023. They used it on glioblastoma cells for Western Blot at a 1:500 dilution and reported it "worked well." Overall, the single review reflects a positive experience with the product performing as expected in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Udesh (Verified Customer) (08-16-2023) | Worked well in WB at 1:500
|
