SNAI2/SLUG Polyclonal antibody

SNAI2/SLUG Polyclonal Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 12129-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF, FC (Intra), CoIP, ChIP, ELISA

SNAI2, Protein snail homolog 2, SLUG, SLUGH, SLUGH1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse testis tissue, mouse brain tissue, rat heart tissue, mouse spleen tissue
Positive IHC detected inhuman skin cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12129-1-AP targets SNAI2/SLUG in WB, IHC, IF, FC (Intra), CoIP, ChIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, zebrafish
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag2773

Product name: Recombinant human SNAI2 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-268 aa of BC015895

Sequence: MPRSFLVKKHFNASKKPNYSELDTHTVIISPYLYESYSMPVIPQPEILSSGAYSPITVWTTAAPFHAQLPNGLSPLSGYSSSLGRVSPPPPSDTSSKDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYVSLGALKMHIRTHTLPCVCKICGKAFSRPWLLQGHIRTHTGEKPFSCPHCNRAFADRSNLRAHLQTHSDVKKYQCKNCSKTFSRMSLLHKHEESGCCVAH

Predict reactive species
Full Name snail homolog 2 (Drosophila)
Calculated Molecular Weight 268 aa, 30 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC015895
Gene Symbol SLUG
Gene ID (NCBI) 6591
RRIDAB_2191889
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43623
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

SNAI2 belongs to the Snail family of zinc finger transcription factors, which shares an evolutionarily conserved role in mesoderm formation in vertebrates and invertebrates. It tiggers epithelial-mesenchymal transitions and has a crucial role in developmental processes. Also it is a transcriptional reperssor in mediating RAF-induced expression of TJ protein, occludin(OCLN) and subsequent oncogenic transformation of epithelial cells.

Protocols

Product Specific Protocols
FC protocol for SNAI2/SLUG antibody 12129-1-APDownload protocol
IHC protocol for SNAI2/SLUG antibody 12129-1-APDownload protocol
WB protocol for SNAI2/SLUG antibody 12129-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Exp Clin Cancer Res

Lnc AC016727.1/BACH1/HIF-1 α signal loop promotes the progression of non-small cell lung cancer

Authors - Li Zhang
humanWB

J Exp Clin Cancer Res

ACTN1 promotes HNSCC tumorigenesis and cisplatin resistance by enhancing MYH9-dependent degradation of GSK-3β and integrin β1-mediated phosphorylation of FAK

Authors - Li Cui
humanWB

Cell Death Dis

UBE2E2 enhances Snail-mediated epithelial-mesenchymal transition and Nrf2-mediated antioxidant activity in ovarian cancer

Authors - Xiaoling Hong
humanWB

Mol Ther

IMPDH1/YB-1 Positive Feedback Loop Assembles Cytoophidia and Represents a Therapeutic Target in Metastatic Tumors.

Authors - Hailong Ruan
mouseWB,IF

Theranostics

Trio cooperates with Myh9 to regulate neural crest-derived craniofacial development.

Authors - Shuyu Guo
humanWB

Cell Death Dis

ZC3H15 promotes glioblastoma progression through regulating EGFR stability.

Authors - Jianbing Hou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Udesh (Verified Customer) (08-16-2023)

Worked well in WB at 1:500

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Glioblastoma cells
Loading...
||
New chat Able
正在加载,请稍候...