SLC7A8 Polyclonal antibody

• 

  WB analysis using 30211-1-AP

  JAR cells were subjected to SDS PAGE followed by western blot with 30211-1-AP (SLC7A8 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 30211-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30211-1-AP (SLC7A8 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 30211-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using SLC7A8 antibody (30211-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

SLC7A8 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 30211-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

Solute carrier family 7 member 8, LAT2

---

Tested Applications

• Positive WB detected in: human placenta tissue, JAR cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30211-1-AP targets SLC7A8 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32957

  Product name: Recombinant human SLC7A8 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 468-535 aa of

  Sequence: YWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKDKDVAGQPQP

• Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 8
• Calculated Molecular Weight: 58 kDa
• Observed Molecular Weight: 45-50 kDa
• Gene Symbol: SLC7A8
• Gene ID (NCBI): 23428
• RRID: AB_3086264
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UHI5
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Solute carrier family 7 member 8 (SLC7A8), also known as LAT2, is an amino acid transporter that, together with LAT1 (SLC7A5), facilitates the bidirectional transport of branched-chain and aromatic AAs across the plasma membrane.