SLC38A9 Recombinant monoclonal antibody

• 

  WB analysis of mouse pancreas using 83182-5-RR

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 83182-5-RR (SLC38A9 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  FC experiment of U2OS using 83182-5-RR

  1x10^6 U2OS cells were intracellularly stained with 0.25 ug Slc38a9 Recombinant Antibody (83182-5-RR, Clone:240039E7) and APC-Conjugated Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

• 

  Affinity and Kinetic Characterization of 83182-5-RR

  Biolayer interferometry (BLl) kinetic assays of 83182-5-RR against Human SLC38A9 were performed. The affinity constant is 0.715 nM.

SLC38A9 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), ELISA

Cat No. 83182-5-RR

Clone No.240039E7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

Synonyms

URLC11, Up-regulated in lung cancer 11, Solute carrier family 38 member 9, Neutral amino acid transporter 9, 240039E7

---

Tested Applications

• Positive WB detected in: mouse pancreas tissue
• Positive FC (Intra) detected in: U2OS cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83182-5-RR targets SLC38A9 in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag15607

  Product name: Recombinant human SLC38A9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-131 aa of BC066891

  Sequence: MANMNSDSRHLGTSEVDHERDPGPMNIQFEPSDLRSKRPFCIEPTNIVNVNHVIQRVSDHASAMNKRIHYYSRLTTPADKALIPPDHVVPAPEECYVYSPLGSAYKLQSYTEGYGKNTSLVTIFMIWNTMM

• Full Name: solute carrier family 38, member 9
• Calculated Molecular Weight: 561 aa, 64 kDa
• Observed Molecular Weight: 50-55 kDa
• GenBank Accession Number: BC066891
• Gene Symbol: SLC38A9
• Gene ID (NCBI): 153129
• RRID: AB_3670872
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8NBW4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mTOR complex 1 (mTORC1) protein kinase is a master growth regulator that responds to multiple environmental cues. The lysosomal amino acid transporter SLC38A9 is a physical and functional component of this sensing complex. SLC38A9 (Solute Carrier Family 38 Member 9) was first identified as a potential amino acid transporter belonging to the slc38 family. SLC38A9 has some isoforms: 64,53,57 kDa.