SLAM/CD150 Polyclonal antibody

• 

  WB analysis using 32660-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 32660-1-AP (SLAM/CD150 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

SLAM/CD150 Polyclonal Antibody for WB, ELISA

Cat No. 32660-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Slamf1, SLAM family member 1, Slam, Signaling lymphocytic activation molecule, CD150

---

Tested Applications

• Positive WB detected in: mouse spleen tissue, mouse thymus tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

32660-1-AP targets SLAM/CD150 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Eg2787

  Product name: Recombinant Mouse SLAM/CD150 protein (rFc Tag) (HPLC verified)

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 25-242 aa of NM_013730.4

  Sequence: TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSP

• Full Name: signaling lymphocytic activation molecule family member 1
• Calculated Molecular Weight: 38 kDa
• Observed Molecular Weight: 70-90 kDa
• GenBank Accession Number: NM_013730.4
• Gene Symbol: Slamf1
• Gene ID (NCBI): 27218
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9QUM4-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Signaling lymphocytic activation molecule (SLAM, also known as SLAMF1 or CD150) is a 70-95 kDa transmembrane glycoprotein that belongs to the immunoglobulin gene superfamily. SLAM is constitutively expressed on peripheral blood memory T-cells, T-cell clones, immature thymocytes and a proportion of B-cells, and is rapidly induced on naive T-cells after activation. SLAM is involved in T cell stimulation and cytokine production, and may play an important role in the regulation of immune responses to pathogens.