Tested Applications
| Positive WB detected in | THP-1 cells, mouse pancreas tissue |
| Positive IF/ICC detected in | THP-1 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
83675-6-RR targets SCTR in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag5371 Product name: Recombinant human SCTR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 36-142 aa of BC035757 Sequence: QVLWEEQDQCLQELSREQTGDLGTEQPVPGCEGMWDNISCWPSSVPGRMVEVECPRFLRMLTSRNGSLFRNCTQDGWSETFPRPNLACGVNVNDSSNEKRHSYLLKL Predict reactive species |
| Full Name | SCTR |
| Calculated Molecular Weight | 440 aa, 50 kDa |
| Observed Molecular Weight | 45-50 kDa |
| GenBank Accession Number | BC035757 |
| Gene Symbol | SCTR |
| Gene ID (NCBI) | 6344 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | P47872 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCTR is a member of the family B G protein-coupled receptors. SCTR is a receptor for SCT, a gastrointestinal peptide hormone secreted by the S cells of the duodenum. SCT regulates water homeostasis throughout the body and influences the environment of the duodenum by regulating SCT in the stomach and pancreas. Studies suggest that SCT can act as a neuropeptide within the central nervous system (CNS), thus SCTR may regulate the function of the CNS.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for SCTR antibody 83675-6-RR | Download protocol |
| WB protocol for SCTR antibody 83675-6-RR | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





