Tested Applications
Positive WB detected in | A431 cells, A375 cells, A549 cells, HepG2 cells |
Positive IHC detected in | mouse liver tissue, human liver tissue, mouse brown adipose tissue, human colon cancer tissue, human ovary tumor tissue, human stomach cancer tissue, rat heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:2000-1:16000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 46 publications below |
IHC | See 6 publications below |
IF | See 2 publications below |
CoIP | See 1 publications below |
Product Information
28678-1-AP targets SCD1 in WB, IHC, IF/ICC, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat, monkey, goat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag29156 Product name: Recombinant human SCD protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-72 aa of BC005807 Sequence: MPAHLLQDDISSSYTTTTTITAPPSRVLQNGGDKLETMPLYLEDDIRPDIKDDIYDPTYKDKEGPSPKVEYV Predict reactive species |
Full Name | stearoyl-CoA desaturase (delta-9-desaturase) |
Calculated Molecular Weight | 355 aa, 41 kDa |
Observed Molecular Weight | 28-42 kDa |
GenBank Accession Number | BC005807 |
Gene Symbol | SCD |
Gene ID (NCBI) | 6319 |
RRID | AB_2923581 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O00767 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
SCD1 (stearoyl-CoA desaturase) is a microsomal fatty acid monodesaturase, which catalyses the committed step in the biosynthesis of mono-unsaturated fatty acids from saturated fatty acids (PMID:10946019). SCD1 and SCD2 are the main isoforms expressed in mouse liver and brain respectively (PMID:15907797). The formation of homodimers and oligomers is an intrinsic property of SCD proteins. SCD1 is a multi-pass membrane protein and detected double bands of 37-42 kDa. The degradation product of 28 kDa may be caused by a major cleavage site at the C-terminus (PMID:15610069, PMID: 9843580).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for SCD1 antibody 28678-1-AP | Download protocol |
IHC protocol for SCD1 antibody 28678-1-AP | Download protocol |
IF protocol for SCD1 antibody 28678-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Adv Sci (Weinh) Transcriptional Regulation of De Novo Lipogenesis by SIX1 in Liver Cancer Cells | ||
ACS Appl Mater Interfaces Lactate-Fueled Theranostic Nanoplatforms for Enhanced MRI-Guided Ferroptosis Synergistic with Immunotherapy of Hepatocellular Carcinoma | ||
Phytomedicine Melittin suppresses ovarian cancer growth by regulating SREBP1-mediated lipid metabolism | ||
Free Radic Biol Med Zinc deficiency drives ferroptosis resistance by lactate production in esophageal squamous cell carcinoma | ||
Inflammation Multiple Machine Learning Identifies Key Gene PHLDA1 Suppressing NAFLD Progression |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH YINGJIAN (Verified Customer) (08-07-2025) | The antibody demonstrates high specificity and strong affinity toward the target protein. Besides, the shipment very quick. It is overnight shipment.
![]() |
FH Marco (Verified Customer) (07-09-2024) | It does its job in NRVCMs
|