Recombinant human SCARB1 protein
Source
e coli.-derived, PGEX-4T
Tag
GST
Format
Liquid
Cat no : Ag15759
Synonyms
CD36L1; CLA-1; CLA1; MGC138242; SR-BI; SRB1
Validation Data Gallery View All
Product Information
| Peptide Sequence |
MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFFDVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNILVLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAELNNSDSGLFTVFTGVQNISR
(1-230 aa encoded by BC022087) |
| Activity | Not tested. |
| Endotoxin Level | Please contact the lab for more information. |
