S100B Recombinant monoclonal antibody, PBS Only

• 

  Affinity and Kinetic Characterization of 82271-12-PBS

  Biolayer interferometry (BLl) kinetic assay of 82271-12-PBS against Human S100B was performed. The affinity constant is 0.289 nM.

S100B Uni-rAb^® Recombinant Antibody for Indirect ELISA

Cat No. 82271-12-PBS

Clone No.230169D2

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Indirect ELISA

Synonyms

S100 beta, Protein S100 B, Protein S100-B, S100 calcium-binding protein B, S-100 protein beta chain

---

Product Information

82271-12-PBS targets S100B in Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag7440

  Product name: Recombinant human S100B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-92 aa of BC001766

  Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

• Full Name: S100 calcium binding protein B
• Calculated Molecular Weight: 11 kDa
• GenBank Accession Number: BC001766
• Gene Symbol: S100 Beta
• Gene ID (NCBI): 6285
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04271
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.