S100B Polyclonal antibody

S100B Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA
Cat No. 15146-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA

S100 beta, Protein S100 B, Protein S100-B, S100 calcium-binding protein B, S-100 protein beta chain

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, A375 cells, human testis tissue, U-251 cells, C6 cells, rat brain tissue
Positive IHC detected inhuman malignant melanoma tissue, human appendicitis tissue, human gliomas tissue, mouse brain tissue, rat brain tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse brain tissue, human malignant melanoma tissue, mouse cerebellum tissue, rat brain tissue
Positive IF/ICC detected inhuman astrocytes, A375 cells
Positive FC (Intra) detected inA375 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:4000-1:20000
Immunohistochemistry (IHC)IHC : 1:1000-1:6000
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.50 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

15146-1-AP targets S100B in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag7440

Product name: Recombinant human S100B protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-92 aa of BC001766

Sequence: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE

Predict reactive species
Full Name S100 calcium binding protein B
Calculated Molecular Weight 11 kDa
Observed Molecular Weight 11 kDa
GenBank Accession NumberBC001766
Gene Symbol S100 Beta
Gene ID (NCBI) 6285
RRIDAB_2254244
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP04271
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

S100B belongs to the EF-hand calcium binding proteins and is found primarily in astrocytes in the central nervous system (CNS). S100B has a variety of functions, including calcium homeostasis, cell proliferation, differentiation, migration, and survival, as well as neurite outgrowth and regeneration.

 1. What is the molecular weight of S100B?

S100B protein is composed of non-covalently linked homodimers of 11 kDa size.

2. What is the subcellular localization of S100B?

S100B localizes to the nucleus and cytoplasm, associating with intracellular membranes, the centrosomes, microtubules, and type III intermediate filaments (PMID: 19110011). Additionally, it can be released from astrocytes into the extracellular space and can enter the bloodstream.

3. What is the expression pattern of S100B?

S100B is predominantly expressed in astrocytes and maturing oligodendrocytes but is also present in other cell types such as kidney epithelial cells, neural progenitor cells, pituicytes, ependymocytes, chondrocytes, adipocytes, melanocytes, Langerhans cells, dendritic cells, certain lymphocyte subpopulations, skeletal myofibers, myoblasts, and muscle satellite cells (PMID: 19110011). S100B is a commonly used marker of Schwann cells and reactive astrocytes in ICC, IHC, and WB applications.

4. What is the diagnostic use of S100B in the clinic?

S100B is naturally secreted by astrocytes into the extracellular space and low amounts of S100B can pass through the brain-blood barrier and enter the bloodstream. Elevated levels of S100B in the serum are observed in patients with traumatic head injuries, as well as in patients suffering from neurodegenerative diseases (PMID: 30144068). This increase in S100B levels is attributed to the elevated secretion of S100B protein from astrocytes as part of the physiological response to the injury, as well as to the physical damage of astrocytes and increased blood-brain barrier permeability.


Protocols

Product Specific Protocols
IF protocol for S100B antibody 15146-1-APDownload protocol
IHC protocol for S100B antibody 15146-1-APDownload protocol
WB protocol for S100B antibody 15146-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nature

Reversing a model of Parkinson's disease with in situ converted nigral neurons.

Authors - Hao Qian
mouseIHC

Nature

Regulation of intestinal immunity and tissue repair by enteric glia

Authors - Fränze Progatzky
mouseIHC

Cell

Mechanoreceptor synapses in the brainstem shape the central representation of touch.

Authors - Brendan P Lehnert
humanIF

Sci Bull (Beijing)

Restoring sweat gland function in mice using regenerative sweat gland cells derived from chemically reprogrammed human epidermal keratinocytes

Authors - Jiangbing Xiang
mouseIF

Nat Commun

Alk1 acts in non-endothelial VE-cadherin+ perineurial cells to maintain nerve branching during hair homeostasis

Authors - Gopal Chovatiya
mouseIF

Neuron

γ-Protocadherins control synapse formation and peripheral branching of touch sensory neurons

Authors - Shan Meltzer

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Xiaohuan (Verified Customer) (11-06-2025)

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: brain organoids
FH

Clarisse (Verified Customer) (08-08-2022)

This antibody works very well as an astrocyte marker. In the image: in green mouse anti-S100B (1:500 - 66616-1-Ig) and in magenta rabbit anti-S100B (1:500 - 15146-1-AP). The rabbit antibody has a better performance.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Human cerebral organoids
S100B Antibody Immunofluorescence validation (1:500 dilution) in Human cerebral organoids (Cat no:15146-1-AP)
FH

Tongcheng (Verified Customer) (09-08-2021)

This antibody works perfect on human astrocytes.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:200
  • Cell Tissue Type: astrocyte
FH

Sonia (Verified Customer) (10-21-2019)

Works really well on mouse sciatic nerve cross section (cryostat)

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1/400
  • Cell Tissue Type: mouse scitic nerve
S100B Antibody Immunofluorescence, validation (1/400 dilution) in mouse scitic nerve (Cat no:15146-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...