Tested Applications
Positive WB detected in | MCF-7 cells, rat stomach tissue |
Positive IP detected in | MCF-7 cells |
Positive IHC detected in | human colon cancer tissue, human skin tissue, human ovary tumor tissue, human breast cancer tissue, human bowen disease, human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Positive IF/ICC detected in | HeLa cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 22 publications below |
IHC | See 18 publications below |
IF | See 5 publications below |
IP | See 2 publications below |
CoIP | See 1 publications below |
Product Information
10489-1-AP targets S100A14 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, rat samples.
Tested Reactivity | human, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag0757 Product name: Recombinant human S100A14 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-104 aa of BC005019 Sequence: MGQCRSANAEDAQEFSDVERAIETLIKNFHQYSVEGGKETLTPSELRDLVTQQLPHLMPSNCGLEEKIANLGSCNDSKLEFRSFWELIGEAAKSVKLERPVRGH Predict reactive species |
Full Name | S100 calcium binding protein A14 |
Calculated Molecular Weight | 12 kDa |
Observed Molecular Weight | 10-12 kDa |
GenBank Accession Number | BC005019 |
Gene Symbol | S100A14 |
Gene ID (NCBI) | 57402 |
RRID | AB_2183628 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9HCY8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
The S100 family is a multifunctional group of EF-hand type calciumbinding proteins. S100A14 protein (previously known as BCMP84, S100A15) is a recently identified member of the S100 family. It is differentially expressed in a number of different human malignancies like ovary, breast, uterus, kidney, rectum and colon cancers, and esophageal and oral squamous cell carcinomas (OSCCs).
Protocols
Product Specific Protocols | |
---|---|
IF protocol for S100A14 antibody 10489-1-AP | Download protocol |
IHC protocol for S100A14 antibody 10489-1-AP | Download protocol |
IP protocol for S100A14 antibody 10489-1-AP | Download protocol |
WB protocol for S100A14 antibody 10489-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Oncogene S100A14 suppresses metastasis of nasopharyngeal carcinoma by inhibition of NF-kB signaling through degradation of IRAK1. | ||
Am J Respir Cell Mol Biol Transcriptomics Analysis Identifies the Decline in the AT2 Stem Cell Niche in Aged Human Lungs | ||
Int J Cancer S100A14 is a novel independent prognostic biomarker in the triple-negative breast cancer subtype. | ||
Cell Death Dis Calcium-binding protein S100A14 induces differentiation and suppresses metastasis in gastric cancer. | ||
Am J Cancer Res A new 7-gene survival score assay for pancreatic cancer patient prognosis prediction. |