CoraLite® Plus 647-conjugated RYR2 Polyclonal antibody

• 

  IF Staining of mouse heart using CL647-27587

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using CoraLite® Plus 647 RYR2 antibody (CL647-27587) at dilution of 1:200.

• 

  IF Staining of mouse heart using CL647-27587

  Immunofluorescent analysis of (4% PFA) fixed mouse heart tissue using CoraLite® Plus 647 RYR2 antibody (CL647-27587) at dilution of 1:200.

RYR2 Polyclonal Antibody for IF-P

Cat No. CL647-27587

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse

Applications

IF-P

Synonyms

ARVC2, ARVD2, ryanodine receptor 2 (cardiac), RYR2, VTSIP

---

Tested Applications

• Positive IF-P detected in: mouse heart tissue

Recommended dilution

• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL647-27587 targets RYR2 in IF-P applications and shows reactivity with Human, mouse samples.

• Tested Reactivity: Human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26296

  Product name: Recombinant human RYR2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1311-1410 aa of NM_001035

  Sequence: MAEVFSKTVAGGLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKPEFNNHKDYAQEKPSRLKQRFLLRRTKPDYSTSHSARLTEDVL

• Full Name: ryanodine receptor 2 (cardiac)
• Calculated Molecular Weight: 565 kDa
• GenBank Accession Number: NM_001035
• Gene Symbol: RYR2
• Gene ID (NCBI): 6262
• RRID: AB_2923952
• Conjugate: CoraLite® Plus 647 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 654 nm / 674 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92736
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

RYR2 belongs to the ryanodine receptor family. RYR2 provides communication between transverse-tubules and sarcoplasmic reticulum. Contraction of cardiac muscle is triggered by release of calcium ions from SR following depolarization of T-tubules. Defects in RYR2 are the cause of familial arrhythmogenic right ventricular dysplasia type 2 (ARVD2) which known as arrhythmogenic right ventricular cardiomyopathy 2 (ARVC2). Defects in RYR2 are the cause of catecholaminergic polymorphic ventricular tachycardia type 1 (CPVT1) which known as stress-induced polymorphic ventricular tachycardia (VTSIP).