RRAD Polyclonal antibody

• 

  WB analysis using 27763-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27763-1-AP (RRAD antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SKOV-3 using 27763-1-AP

  WB result of RRAD antibody (27763-1-AP; 1:5000; incubated at room temperature for 1.5 hours) with sh-Control and sh-RRAD transfected SKOV-3 cells.

• Featured Product
• KD/KO Validated

RRAD Polyclonal Antibody for WB, ELISA

Cat No. 27763-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

Ras associated with diabetes, RAD1, RAD, GTP-binding protein RAD, GTP binding protein RAD

---

Tested Applications

• Positive WB detected in: mouse heart tissue, SKOV-3 cells, rat heart tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

27763-1-AP targets RRAD in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26869

  Product name: Recombinant human RRAD protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 39-141 aa of BC057815

  Sequence: SMPVDERDLQAALTPGALTAAAAGTGTQGPRLDWPEDSEDSLSSGGSDSDESVYKVLLLGAPGVGKSALARIFGGVEDGPEAEAAGHTYDRSIVVDGEEASLM

• Full Name: Ras-related associated with diabetes
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 29-34 kDa
• GenBank Accession Number: BC057815
• Gene Symbol: RRAD
• Gene ID (NCBI): 6236
• RRID: AB_3085993
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55042
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RRAD is also named as RAD1. RRAD, a member of the Ras-like small GTPase family, was initially identified as a gene associated with Type II diabetes since it was found to be overexpressed in some Type II diabetic patients (PMID: 8248782). RRAD overexpression reduced insulin-stimulated glucose uptake in cultured muscle and adipocytes cells (PMID: 8798502). RRAD was found to be frequently down-regulated in different types of human cancers, including lung cancer, breast cancer, and nasopharyngeal carcinoma, etc, due to the hypermethylation of its promoter (PMID: 17195088).