RPA1 Polyclonal antibody

• 

  WB analysis using 12448-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 12448-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 12448-1-AP

  K-562 cell lysates were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Y79 using 12448-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 12448-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

RPA1 Polyclonal Antibody for WB, ELISA

Cat No. 12448-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

HSSB, MST075, REPA1, Replication factor A protein 1, Replication protein A 70 kDa DNA-binding subunit

---

Tested Applications

• Positive WB detected in: HEK-293 cells, K-562 cells, Y79 cells, A431 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

12448-1-AP targets RPA1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3067

  Product name: Recombinant human RPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 317-616 aa of BC018126

  Sequence: VDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM

• Full Name: replication protein A1, 70kDa
• Calculated Molecular Weight: 616 aa, 68 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC018126
• Gene Symbol: RPA1
• Gene ID (NCBI): 6117
• RRID: AB_2180495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27694
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Replication protein A 1 (RPA1) is a subunit of a stable heterotrimer replication protein A (RPA), which is conserved in almost all eukaryotic species (PMID: 27151292). Usually, RPA1, RPA2 and RPA3 function as a whole to participate in DNA replication, telomere maintenance, DNA recombination, DNA repair, and activation of DNA damage checkpoints. In the cell, RPA has a higher affinity to bind single strand DNA and then to form a fork protection complex with other components such as PTEN and OTUB1, thus maintains genome stability during replication(PMID: 26403191; PMID: 18469000).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; PMID: 31249811; Authors - Ma-Sha Huang