RPA1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RPA1 Polyclonal antibody (12448-1-AP)

RPA1 Polyclonal Antibody for WB, ELISA

Cat No. 12448-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

HSSB, MST075, REPA1, Replication factor A protein 1, Replication protein A 70 kDa DNA-binding subunit

• 

  WB analysis using 12448-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 12448-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of Y79 using 12448-1-AP

  Y79 cells were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 12448-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 12448-1-AP

  K-562 cell lysates were subjected to SDS PAGE followed by western blot with 12448-1-AP (RPA1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RPA1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, K-562 cells, Y79 cells, A431 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12448-1-AP targets RPA1 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3067

  Product name: Recombinant human RPA1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 317-616 aa of BC018126

  Sequence: VDIIGICKSYEDATKITVRSNNREVAKRNIYLMDTSGKVVTATLWGEDADKFDGSRQPVLAIKGARVSDFGGRSLSVLSSSTIIANPDIPEAYKLRGWFDAEGQALDGVSISDLKSGGVGGSNTNWKTLYEVKSENLGQGDKPDYFSSVATVVYLRKENCMYQACPTQDCNKKVIDQQNGLYRCEKCDTEFPNFKYRMILSVNIADFQENQWVTCFQESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFRSFIFRVRVKVETYNDESRIKATVMDVKPVDYREYGRRLVMSIRRSALM

• Full Name: replication protein A1, 70kDa
• Calculated Molecular Weight: 616 aa, 68 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC018126
• Gene Symbol: RPA1
• Gene ID (NCBI): 6117
• RRID: AB_2180495
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P27694
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Replication protein A 1 (RPA1) is a subunit of a stable heterotrimer replication protein A (RPA), which is conserved in almost all eukaryotic species (PMID: 27151292). Usually, RPA1, RPA2 and RPA3 function as a whole to participate in DNA replication, telomere maintenance, DNA recombination, DNA repair, and activation of DNA damage checkpoints. In the cell, RPA has a higher affinity to bind single strand DNA and then to form a fork protection complex with other components such as PTEN and OTUB1, thus maintains genome stability during replication(PMID: 26403191; PMID: 18469000).

Publications

What published studies show

The RPA1 Polyclonal antibody (Cat# 12448-1-AP) has 2 citations. These publications appear in Frontiers in Oncology and Experimental and Therapeutic Medicine. The research fields covered include non-small cell lung cancer progression and cisplatin sensitivity, as well as glioma development and progression. Both studies utilized the antibody for Western blot, with one also employing IHC, in human samples.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Oncol; PMID: 31249811; Authors - Ma-Sha Huang
human	WB,IHC	Exp Ther Med; Role and mechanism of RPA1 in the development and progression of glioma; Authors - Zhiming Zhao