Use Able AI chat for product recommendations

Renin Polyclonal antibody

Renin Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IHC, IF/ICC, ELISA

REN, Angiotensinogenase, EC:3.4.23.15

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Renin in ?

Tested Applications

Positive WB detected inK-562 cells, HepG2 cells
Positive IHC detected inhuman kidney tissue, human gliomas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells, HepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

14291-1-AP targets Renin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag5612

Product name: Recombinant human REN protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-406 aa of BC047752

Sequence: MDGWRRMPRWGLLLLLWGSCTFGLPTDTTTFKRIFLKRMPSIRESLKERGVDMARLGPEWSQPMKRLTLGNTTSSVILTNYMDTQYYGEIGIGTPPQTFKVVFDTGSSNVWVPSSKCSRLYTACVYHKLFDASDSSSYKHNGTELTLRYSTGTVSGFLSQDIITVGGITVTQMFGEVTEMPALPFMLAEFDGVVGMGFIEQAIGRVTPIFDNIISQGVLKEDVFSFYYNRDSENSQSLGGQIVLGGSDPQHYEGNFHYINLIKTGVWQIQMKGVSVGSSTLLCEDGCLALVDTGASYISGSTSSIEKLMEALGAKKRLFDYVVKCNEGPTLPDISFHLGGKEYTLTSADYVFQESYSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALAR

Predict reactive species
Full Name renin
Calculated Molecular Weight 45 kDa
Observed Molecular Weight45 kDa
GenBank Accession NumberBC047752
Gene Symbol Renin
Gene ID (NCBI) 5972
RRIDAB_10695894
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP00797
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REN(Renin) is also named as angiotensinogenase and belongs to the peptidase A1 family. It is a highly specific endopeptidase, whose only known function is to generate angiotensin I from angiotensinogen in the plasma, initiating a cascade of reactions that produce an elevation of blood pressure and increased sodium retention by the kidney. Human prorenin and renin are synthesized in juxtaglomerular cells and it locates in the juxtaglomerular cells and afferent arteriole as cytoplasmic granules (PMID:19664745, 9453303). REN has 2 isoforms produced by alternative splicing with the molecular weight of 45-47kDa. The mature REN can be detected as 38-42 kDa due to the cleavage of signal peptide and propeptide, and also detected as 55-60 kDa with variable degrees of glycosylation (PMID: 20966072, 15226276).Defects in REN are a cause of renal tubular dysgenesis (RTD) and familial juvenile hyperuricemic nephropathy type 2 (HNFJ2).

Protocols

Product Specific Protocols
IF protocol for Renin antibody 14291-1-APDownload protocol
IHC protocol for Renin antibody 14291-1-APDownload protocol
WB protocol for Renin antibody 14291-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Renin Antibody (Cat# 14291-1-AP) has 24 total citations published across journals including Hypertension, Plant Physiology, British Journal of Pharmacology, Antioxidants & Redox Signaling, JAHA, Cells, European Journal of Pharmacology, Biomolecules, International Journal of Molecular Sciences, American Journal of Physiology, Scientific Reports, Journal of Physiology, Human Pathology, and others. Research fields encompass the renin-angiotensin system, hypertension, renal fibrosis, cancer stem cells, vascular smooth muscle biology, neuroprotection, complement signaling, and developmental physiology.

SpeciesApplicationTitle
mouseIHC

Hypertension

Dysregulation of Aldosterone Secretion in Mast Cell-Deficient Mice.

Authors - Hadrien-Gaël Boyer
WB

Plant Physiol

Lysine malonylation of DgnsLIPID TRANSFER PROTEIN1 at the K81 site improves cold resistance in chrysanthemum

Authors - Xiaoqin Liao
humanWB

Br J Pharmacol

Novel inhibitors of the cellular RAS components, Poricoic acids, target Smad3 phosphorylation and Wnt/β-catenin pathway against renal fibrosis.

Authors - Ming Wang
ratIHC

Antioxid Redox Signal

Silencing of central (Pro)renin receptor ameliorates salt-induced renal injury in CKD.

Authors - Jiawen Li
humanWB

J Agric Food Chem

Novel RAS Inhibitors Poricoic Acid ZG and Poricoic Acid ZH Attenuate Renal Fibrosis via a Wnt/β-Catenin Pathway and Targeted Phosphorylation of smad3 Signaling.

Authors - Ming Wang
mouseWB

J Neuroimmune Pharmacol

Activation of Hippocampal ACE2 Prevents the Dysbiosis-induced Depression-like Behavior in Mice by Enhanced Neurogenesis and Neuroprotection via Mas Receptor.

Authors - Minoru Tsuji
Loading...
||
New chat

Able™

正在加载,请稍候...