Calcipressin 1 Polyclonal antibody

• 

  WB analysis using 14869-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (Calcipressin 1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SKOV-3 cells using 14869-1-AP

  WB result of RCAN1 antibody (14869-1-AP, 1:1000) with si-control and si-RCAN1 transfected SKOV-3 cells.

• 

  WB analysis of mouse skeletal muscle using 14869-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse heart using 14869-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 14869-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse cerebellum using 14869-1-AP

  mouse cerebellum tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 14869-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of SKOV-3 using 14869-1-AP

  SKOV-3 cells were subjected to SDS PAGE followed by western blot with 14869-1-AP (RCAN1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 14869-1-AP

  IP result of anti-Calcipressin 1 (IP:14869-1-AP, 4ug; Detection:14869-1-AP 1:500) with mouse brain tissue lysate 4000ug.

• 

  IHC staining of human colon cancer using 14869-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14869-1-AP (RCAN1 Antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human colon cancer using 14869-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 14869-1-AP (RCAN1 Antibody) at dilution of 1:200 (under 40x lens).

• Featured Product
• KD/KO Validated

Calcipressin 1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 14869-1-AP

Publications(2)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IP, ELISA

Synonyms

ADAPT78, Calcipressin 1, CSP1, DSC1, DSCR1, MCIP1, RCAN1, RCN1, regulator of calcineurin 1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, SKOV-3 cells, human heart tissue, mouse skeletal muscle tissue, mouse heart tissue, A431 cells, mouse cerebellum tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below

Product Information

14869-1-AP targets Calcipressin 1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6457

  Product name: Recombinant human RCAN1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-197 aa of BC002864

  Sequence: MEEVDLQDLPSATIACHLDPRVFVDGLCRAKFESLFRTYDKDITFQYFKSFKRVRINFSNPFSAADARLQLHKTEFLGKEMKLYFAQTLHIGSSHLAPPNPDKQFLISPPASPPVGWKQVEDATPVINYDLLYAISKLGPGEKYELHAATDTTPSVVVHVCESDQEKEEEEEMERMRRPKPKIIQTRRPEYTPIHLS

• Full Name: regulator of calcineurin 1
• Calculated Molecular Weight: 28 kDa
• Observed Molecular Weight: 25-29 kDa
• GenBank Accession Number: BC002864
• Gene Symbol: RCAN1
• Gene ID (NCBI): 1827
• RRID: AB_10640904
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P53805
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Free Radic Biol Med; N6-methyladenosine modification of SPOP relieves ferroptosis and diabetic cardiomyopathy by enhancing ubiquitination of VDAC3; Authors - Wei Meng
human	WB	Front Med (Lausanne); The identification of hub-methylated differentially expressed genes in osteoarthritis patients is based on epigenomic and transcriptomic data; Authors - Zhen-Chen Chu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xu (Verified Customer) (10-06-2020)

It can produce a clear band in mouse brain with a stronger one in Ts65Dn mouse due to gene dose.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1500
• Cell Tissue Type: mouse brain

Calcipressin 1 Antibody Western Blot validation (1:1500 dilution) in mouse brain (Cat no:14869-1-AP)