Tested Applications
| Positive WB detected in | mouse liver tissue, HEK-293 cells, human brain tissue, human liver tissue, rat liver tissue | 
| Positive IHC detected in | human liver cancer tissue, human colon cancer tissue,  human liver tissue,  human ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0  | 
| Positive IF/ICC detected in | HEK-293 cells | 
Recommended dilution
| Application | Dilution | 
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 | 
| Immunohistochemistry (IHC) | IHC : 1:1000-1:4000 | 
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 | 
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below | 
| WB | See 7 publications below | 
| IHC | See 4 publications below | 
| IF | See 1 publications below | 
Product Information
22683-1-AP targets RBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat | 
| Cited Reactivity | human, mouse, rat | 
| Host / Isotype | Rabbit / IgG | 
| Class | Polyclonal | 
| Type | Antibody | 
| Immunogen | 
                                             CatNo: Ag18572 Product name: Recombinant human RBP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-135 aa of BC121052 Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ Predict reactive species | 
                                    
| Full Name | retinol binding protein 1, cellular | 
| Calculated Molecular Weight | 135 aa, 16 kDa | 
| Observed Molecular Weight | 14-21 kDa | 
| GenBank Accession Number | BC121052 | 
| Gene Symbol | RBP1 | 
| Gene ID (NCBI) | 5947 | 
| RRID | AB_11182381 | 
| Conjugate | Unconjugated | 
| Form | Liquid | 
| Purification Method | Antigen affinity purification | 
| UNIPROT ID | P09455 | 
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. | 
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. | 
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RBP1 antibody 22683-1-AP | Download protocol | 
| IHC protocol for RBP1 antibody 22683-1-AP | Download protocol | 
| WB protocol for RBP1 antibody 22683-1-AP | Download protocol | 
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols | 
Publications
| Species | Application | Title | 
|---|---|---|
Metabolism Disruption of retinoid homeostasis induces RBP4 overproduction in diabetes: O-GlcNAcylation involved. | ||
Transl Oncol Identification of metastasis-associated exoDEPs in colorectal cancer using label-free proteomics. | ||
Brain Sci Intraoperative Hypothermia Induces Vascular Dysfunction in the CA1 Region of Rat Hippocampus. | ||
J Food Biochem Inhibitory effect of chitooligosaccharides on retinol metabolism and bioavailability in mice. | ||
Cell Death Dis The RBP1-CKAP4 axis activates oncogenic autophagy and promotes cancer progression in oral squamous cell carcinoma.
  | ||
FASEB J The downregulation of HSP90-controlled CRALBP expression is associated with age-related vision attenuation | 
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Melissa (Verified Customer) (06-13-2022)  | We have used the antibody and it worked out 
  | 

























