Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

RBP1 Polyclonal antibody

RBP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Cellular retinol-binding protein, Cellular retinol-binding protein I, CRABP I, CRBP I, CRBP1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for RBP1 in ?

Tested Applications

Positive WB detected inmouse liver tissue, HEK-293 cells, human brain tissue, human liver tissue, rat liver tissue
Positive IHC detected inhuman liver cancer tissue, human colon cancer tissue, human liver tissue, human ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:1000-1:4000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22683-1-AP targets RBP1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18572

Product name: Recombinant human RBP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-135 aa of BC121052

Sequence: MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRNYIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEMRVEGVVCKQVFKKVQ

Predict reactive species
Full Name retinol binding protein 1, cellular
Calculated Molecular Weight 135 aa, 16 kDa
Observed Molecular Weight 14-21 kDa
GenBank Accession NumberBC121052
Gene Symbol RBP1
Gene ID (NCBI) 5947
RRIDAB_11182381
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP09455
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Protocols

Product Specific Protocols
IF protocol for RBP1 antibody 22683-1-APDownload protocol
IHC protocol for RBP1 antibody 22683-1-APDownload protocol
WB protocol for RBP1 antibody 22683-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

The anti-RBP1 antibody (Cat# 22683-1-AP) has 14 citations published in journals including Nature Communications, Metabolism, Cell Death & Disease, Cell Communication and Signaling, Journal of Biological Chemistry, FASEB Journal, Journal of Molecular and Cellular Cardiology, Translational Oncology, Neural Regeneration Research, Molecular Neurobiology, Journal of Translational Medicine, Brain Sciences, Journal of Food Biochemistry, and European Journal of Histochemistry. Research fields span cancer biology, retinal degeneration, cardiac hypertrophy, diabetes, developmental biology, and neurology.

SpeciesApplicationTitle

Nat Commun

TGFβ-mediated dural progenitor cell migration into the coronal suture is crucial for preventing craniosynostosis.

Authors - Peng Chen
mouseIHC

Metabolism

Disruption of retinoid homeostasis induces RBP4 overproduction in diabetes: O-GlcNAcylation involved.

Authors - Shyi-Jang Shin
humanWB,IHC,IF

Cell Death Dis

The RBP1-CKAP4 axis activates oncogenic autophagy and promotes cancer progression in oral squamous cell carcinoma.

Authors - Ling Gao
  • KD Validated
human,mouseWB,IHC

Cell Commun Signal

In vivo CRISPR screening identifies POU3F3 as a novel regulator of ferroptosis resistance in hepatocellular carcinoma via retinoic acid signaling

Authors - Yu Tian
mouseWB

J Transl Med

Notch3 enhances the synergistic effect of all-trans retinoic acid and calcipotriol in pancreatic stellate cell activation

Authors - Zheng Lian
humanWB

Neural Regen Res

AAV2-PDE6B restores retinal structure and function in the retinal degeneration 10 mouse model of retinitis pigmentosa by promoting phototransduction and inhibiting apoptosis

Authors - Ruiqi Qiu

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

The product has one verified review (5/5 stars) from a researcher who used it for Western Blot and Immunofluorescence on endothelial cells at a 1:1 dilution. The reviewer reported that the antibody "worked out" as expected, indicating satisfactory performance in both applications. Overall, the limited feedback reflects positive results, though the sample size is small.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Melissa (Verified Customer) (06-13-2022)

We have used the antibody and it worked out

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1
  • Cell Tissue Type: Endothelial cells
Loading...
||
New chat

Able™

正在加载,请稍候...