RAB5A Monoclonal antibody, PBS Only

RAB5A Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA
Cat No. 66339-1-PBS
Clone No.1B6A5

Host / Isotype

Mouse / IgG2b

Reactivity

human, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

RAB5, 1B6A5, EC:3.6.5.2, Ras related protein Rab 5A, Ras-related protein Rab-5A

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66339-1-PBS targets RAB5A in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, pig samples.

Tested Reactivity human, pig
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag16781

Product name: Recombinant human RAB5A protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-215 aa of BC001267

Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN

Predict reactive species
Full Name RAB5A, member RAS oncogene family
Calculated Molecular Weight 215 aa, 24 kDa
Observed Molecular Weight 24 kDa
GenBank Accession NumberBC001267
Gene Symbol RAB5A
Gene ID (NCBI) 5868
RRIDAB_2881719
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20339
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Rab5a belongs to the Rab GTPases family proteins, which play roles in endocytosis, exocytosis, and vesicular transportation. Rab family proteins were recently reported to play important roles in human cancer progression. Rab5a was reported to be overexpressed in breast and ovarian cancers and associated with proliferation and invasion.

Loading...
||
New chat Able
正在加载,请稍候...