RAB35 Polyclonal antibody

• 

  WB analysis using 11329-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11329-2-AP (RAB35 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 11329-2-AP

  WB result of RAB35 antibody (11329-2-AP; 1:1200; incubated at room temperature for 1.5 hours) with sh-Control and sh-RAB35 transfected A431 cells.

• 

  WB analysis of MCF-7 using 11329-2-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 11329-2-AP (RAB35 antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of RAW 264.7 using 11329-2-AP

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 11329-2-AP (RAB35 antibody) at dilution of 1:600 incubated at 4 degree celsius over night.

• 

  WB analysis of HeLa using 11329-2-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 11329-2-AP (RAB35 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 11329-2-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 11329-2-AP (RAB35 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 11329-2-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 11329-2-AP (RAB35 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 11329-2-AP

  IP result of anti-RAB35 (IP:11329-2-AP, 4ug; Detection:11329-2-AP 1:600) with mouse brain tissue lysate 2400 ug.

• 

  IHC staining of human breast cancer using 11329-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11329-2-AP (RAB35 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 11329-2-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11329-2-AP (RAB35 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 11329-2-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11329-2-AP (RAB35 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver using 11329-2-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 11329-2-AP (RAB35 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 11329-2-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 11329-2-AP (RAB35 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human brain using 11329-2-AP

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 11329-2-AP (RAB35 Antibody) at dilution of 1:50 (under 40x lens).

• 

  IF Staining of U-87 MG using 11329-2-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed U-87 MG cells using RAB35 antibody (11329-2-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

RAB35 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 11329-2-AP

Publications(49)

Reviews (3)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

Ras-related protein Rab-1C, Ras related protein Rab 35, Ras related protein Rab 1C, RAB1C, GTP-binding protein RAY

---

Tested Applications

• Positive WB detected in: A431 cells, A375 cells, human brain tissue, HeLa cells, MCF-7 cells, RAW 264.7 cells, mouse brain tissue, rat brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human breast cancer tissue, human liver tissue, human brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-87 MG cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 12 publications below
• WB: See 39 publications below
• IHC: See 2 publications below
• IF: See 18 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

11329-2-AP targets RAB35 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, pig, canine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1872

  Product name: Recombinant human RAB35 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-201 aa of BC015931

  Sequence: MARDYDHLFKLLIIGDSGVGKSSLLLRFADNTFSGSYITTIGVDFKIRTVEINGEKVKLQIWDTAGQERFRTITSTYYRGTHGVIVVYDVTSAESFVNVKRWLHEINQNCDDVCRILVGNKNDDPERKVVETEDAYKFAGQMGIQLFETSAKENVNVEEMFNCITELVLRAKKDNLAKQQQQQQNDVVKLTKNSKRKKRCC

• Full Name: RAB35, member RAS oncogene family
• Calculated Molecular Weight: 201 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC015931
• Gene Symbol: RAB35
• Gene ID (NCBI): 11021
• RRID: AB_2238179
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15286
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB35 is a member of the small GTPase superfamily. Like the other Rab proteins, RAB35 has 2 consecutive cysteine residues at its C terminus, and this region is thought to be involved in membrane association. Rab35 is found on the cell surface and endosomes, where it has been proposed to play a role in recycling of the transferrin and other receptors.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Science; Identification of an oncogenic RAB protein.; Authors - Douglas B Wheeler ; KD Validated
human	WB	Cell Metab; Oligodendrocytes Provide Antioxidant Defense Function for Neurons by Secreting Ferritin Heavy Chain.; Authors - Chaitali Mukherjee
human	WB	Nat Cell Biol; An ARF6-Exportin-5 axis delivers pre-miRNA cargo to tumour microvesicles.; Authors - James W Clancy
human	WB	Nat Cell Biol; Protein kinase N controls a lysosomal lipid switch to facilitate nutrient signalling via mTORC1.; Authors - Alexander Wallroth
mouse	WB,IF	Sci Adv; LRRK2 mediates tubulation and vesicle sorting from lysosomes.; Authors - Luis Bonet-Ponce
human,mouse	WB,IHC,IF,CoIP	Nat Commun; A RAB35-p85/PI3K axis controls oscillatory apical protrusions required for efficient chemotactic migration.; Authors - Corallino Salvatore ; KD Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Xin (Verified Customer) (03-15-2022)

A clean antibody to probe Rab35 with the right MW.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: human postmortem brain lysate

RAB35 Antibody Western Blot validation (1:2000 dilution) in human postmortem brain lysate (Cat no:11329-2-AP)

FH

Tom (Verified Customer) (02-24-2021)

HEK293T whole cell lysate probed with Rab35 antibody overnight at 4 degrees. Membrane was blocked in 5% BSA for one hour prior to incubation with antibody.

• Applications: Western Blot
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: HEK293T

RAB35 Antibody Western Blot validation (1:2000 dilution) in HEK293T (Cat no:11329-2-AP)

FH

Mayur (Verified Customer) (01-14-2019)

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse brain tissue (Cortex)

RAB35 Antibody Western Blot, validation (1:1000 dilution) in Mouse brain tissue (Cortex) (Cat no:11329-2-AP)