Product Information
CL647-22034 targets PTEN in applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17274 Product name: Recombinant human PTEN protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 204-403 aa of BC005821 Sequence: PMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEIDSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEASSSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHTQITK Predict reactive species |
| Full Name | phosphatase and tensin homolog |
| Calculated Molecular Weight | 47 kDa |
| Observed Molecular Weight | 55 kDa, 68 kDa |
| GenBank Accession Number | BC005821 |
| Gene Symbol | PTEN |
| Gene ID (NCBI) | 5728 |
| Conjugate | CoraLite® Plus 647 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 654 nm / 674 nm |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P60484 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Phosphatase and tensin homolog (PTEN) is an enzyme key in cell cycle regulation and in tumor suppression.
What is the molecular weight of PTEN?
PTEN is composed of 403 amino acid residues with an N-terminal domain with phosphatase activity and a
C-terminal C2 domain that binds phospholipid membranes (PMID:14749127). This antibody can recognize
two isoforms with MWs of 55kDa and 68 kDa.
What is the function of PTEN?
Widely expressed throughout the body, PTEN is found in the cytoplasm and inhibits cell cycle progression
through phosphatase activity. It regulates intracellular levels of phosphatidylinositol-3,4,5-trisphosphate (PIP3)
by catalyzing the dephosphorylation of the inositol ring. This function counteracts the growth-stimulating
activity of the PI3K/AKT signaling pathway and thereby suppresses proliferation. Therefore, in homeostasis,
PTEN promotes chromosome stability and DNA repair (PMID: 24387334).Expression and function can be
regulated by posttranslational modifications, including acetylation for decreased catalytic activity and
ubiquitination for protein degradation, nuclear localization, and inhibition of phosphatase activity
(PMID: 24656806).
What is the role of PTEN in cancer?
PTEN was first identified as a tumor suppressor when mutations or deletions were identified by two separate
groups in a number of different cancer types including gliomas, breast, prostate, and kidney cancer
(PMID: 9090379; PMID: 9072974). Non-inherited, or somatic, mutations in PTEN that lead to a loss of function
in the protein have been shown to drive malignancy in tumors. PTEN hamartoma tumor syndrome (PHTS) is a
group of inherited disorders that occur as a result of autosomal dominant mutations in the PTEN gene. These
disorders include Cowden syndrome, Bannayan-Riley-Ruvalcaba syndrome, and Proteus syndrome. Because of
the constitutive expression of PTEN, the symptoms are varied but often include neurodevelopmental issues and
an increased risk of developing tumors, both benign and malignant (PMID: 26564076).
