Tested Applications
| Positive WB detected in | HeLa cells, HEK-293 cells, Jurkat cells, NIH/3T3 cells, human peripheral blood platelets, rat kidney tissue |
| Positive IP detected in | NIH/3T3 cells |
| Positive IHC detected in | human thyroid cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat eye tissue |
| Positive IF/ICC detected in | HeLa cells, NIH/3T3 cells, HepG2 cells |
| Positive FC (Intra) detected in | HeLa cells, Jurkat cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 2 publications below |
| WB | See 49 publications below |
| IHC | See 3 publications below |
| IF | See 14 publications below |
| IP | See 1 publications below |
Product Information
21991-1-AP targets PKC Alpha in WB, IHC, IF/ICC, IF-P, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag17275 Product name: Recombinant human PRKCA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-216 aa of BC109274 Sequence: MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGFGKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGSLLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDAKNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIR Predict reactive species |
| Full Name | protein kinase C, alpha |
| Calculated Molecular Weight | 77 kDa |
| Observed Molecular Weight | 77 kDa |
| GenBank Accession Number | AK055431 |
| Gene Symbol | PKC Alpha |
| Gene ID (NCBI) | 5578 |
| RRID | AB_2878965 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P17252 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and the second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets and are known to be involved in diverse cellular signaling pathways. PKC family members also serve as major receptors for phorbol esters, a class of tumor promoters. Each member of the PKC family has a specific expression profile and is believed to play a distinct role in cells. PRKCA is one of the PKC family members. This kinase has been reported to play roles in many different cellular processes, such as cell adhesion, cell transformation, cell cycle checkpoint, and cell volume control. Knockout studies in mice suggest that this kinase may be a fundamental regulator of cardiac contractility and Ca(2+) handling in myocytes.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| IHC protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| IP protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| WB protocol for PKC Alpha antibody 21991-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Adv Sci (Weinh) LncRNA Foxo6os as a Novel " Scaffold" Mediates MYBPC3 in Combating Pathological Cardiac Hypertrophy and Heart Failure | ||
Cancer Lett RSK2-mediated phosphorylation and degradation of UBE2O inhibits hepatocellular carcinoma growth and resistance to radiotherapy | ||
Theranostics MED13L integrates Mediator-regulated epigenetic control into lung cancer radiosensitivity. | ||
Cell Death Dis ATF4/CEMIP/PKCα promotes anoikis resistance by enhancing protective autophagy in prostate cancer cells. | ||
Cell Death Differ β-Trcp ubiquitin ligase and RSK2 kinase-mediated degradation of FOXN2 promotes tumorigenesis and radioresistance in lung cancer. | ||
Oncogene β-Trcp and CK1δ-mediated degradation of LZTS2 activates PI3K/AKT signaling to drive tumorigenesis and metastasis in hepatocellular carcinoma. |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Gaurav (Verified Customer) (12-05-2025) | Works with Primary Cells
|
FH Alessandro (Verified Customer) (11-07-2022) | no unspecific staining, great outcome
|
FH Chiara (Verified Customer) (10-04-2021) | Works very well in Immunoblot
|
FH Samantha (Verified Customer) (02-24-2020) | Bovine vascular smooth muscle cells were transfected with either control siRNA or PKCalpha siRNA for up to 7 days, with transfections repeated every 48-72 hours. Blocking agent: 5% (w/v) milk in TBST for 1hrPrimary antibody diluted in 5% (w/v) milk in TBST; incubated overnight at 4 degrees.
![]() |
FH Ryan (Verified Customer) (01-10-2018) |
![]() |



































