• Featured Product
  • KD/KO Validated

AMPK Alpha Polyclonal antibody

AMPK Alpha Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 10929-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (6)

Applications

WB, IHC, IF/ICC, IP, ELISA

AMPK Alpha 1, PRKAA1, 5'-AMP-activated protein kinase catalytic subunit alpha-1, AAPK1, ACACA kinase

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, Jurkat cells, NIH/3T3 cells, J774A.1 cells, RAW 264.7 cells, PC-12 cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman prostate cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10929-2-AP targets AMPK Alpha in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, zebrafish, goat, fish, carp
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1367

Product name: Recombinant human AMPK alpha protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-207 aa of BC012622

Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH

Predict reactive species
Full Name protein kinase, AMP-activated, alpha 1 catalytic subunit
Calculated Molecular Weight 63 kDa
Observed Molecular Weight 64 kDa
GenBank Accession NumberBC012622
Gene Symbol AMPK Alpha 1
Gene ID (NCBI) 5562
RRIDAB_2169568
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ13131
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing.10929-2-AP can recognize both AMPK Alpha 1 and AMPK Alpha 2.

Protocols

Product Specific Protocols
IF protocol for AMPK Alpha antibody 10929-2-APDownload protocol
IHC protocol for AMPK Alpha antibody 10929-2-APDownload protocol
IP protocol for AMPK Alpha antibody 10929-2-APDownload protocol
WB protocol for AMPK Alpha antibody 10929-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nature

Feeding induces cholesterol biosynthesis via the mTORC1-USP20-HMGCR axis.

Authors - Xiao-Yi Lu

Signal Transduct Target Ther

Glibenclamide targets MDH2 to relieve aging phenotypes through metabolism-regulated epigenetic modification

Authors - Zhifan Mao
mouseWB

Adv Sci (Weinh)

Mitigating Doxorubicin-Induced Cardiotoxicity and Enhancing Anti-Tumor Efficacy with a Metformin-Integrated Self-Assembled Nanomedicine

Authors - Jiaxin Huang

Adv Sci (Weinh)

POSTN-Mediated Interplay of M1 Polarized Macrophage with Tendon-Derived Stem Cells to Drive Traumatic Heterotopic Ossification Formation through PTK7/ATK Signaling

Authors - Hang Liu
humanWB

Autophagy

Periplocin suppresses the growth of colorectal cancer cells by triggering LGALS3 (galectin 3)-mediated lysophagy

Authors - Kui Wang
humanWB,IP

Autophagy

The AMPK-MFN2 axis regulates MAM dynamics and autophagy induced by energy stresses.

Authors - Yongquan Hu
  • KO Validated

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Mallikarjun (Verified Customer) (02-04-2026)

Works very well

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: Leukemia
FH

MANOBENDRO NATH (Verified Customer) (11-07-2025)

Excellent antibody!

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:10000
  • Cell Tissue Type: U2OS
FH

MANOBENDRO NATH (Verified Customer) (10-09-2025)

Very nice antibody.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:5000
  • Cell Tissue Type: HeLa
AMPK Alpha Antibody Western Blot validation (1:5000 dilution) in HeLa (Cat no:10929-2-AP)
FH

Nishita (Verified Customer) (09-12-2025)

Worked pretty well, but we had to use a more concentrated dilution than the one recommended by the site.

  • Applications: Western Blot, Immunofluorescence
  • Primary Antibody Dilution: 1:1000 for WB, 1:100 for IF
  • Cell Tissue Type: NB1 Fibroblasts
FH

Priya (Verified Customer) (10-03-2024)

Used this antibody for colon carcinoma cell line and mice tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 1000
  • Cell Tissue Type: Caco2, Mice colon
FH

Charlotte (Verified Customer) (08-15-2024)

Done in milk but got quite some background. I tried in seablock but not sure it helps. Otherwise nice antibody with one intense band at the expected MW

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/5000
  • Cell Tissue Type: NIH-3T3
AMPK Alpha Antibody Western Blot validation (1/5000 dilution) in NIH-3T3 (Cat no:10929-2-AP)
FH

Priya (Verified Customer) (06-21-2023)

Used this antibody for Caco2 cells andmice tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 1000
  • Cell Tissue Type: Caco2, Mice colon
FH

Priya (Verified Customer) (06-21-2023)

Used this antibody for Caco2 cells andmice tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1 to 1000
  • Cell Tissue Type: Caco2, Mice colon
FH

LUNFENG (Verified Customer) (01-27-2020)

GOOD

  • Applications: Immunofluorescence,
  • Cell Tissue Type: HEART
FH

Jing (Verified Customer) (01-27-2020)

tested in mouse heart lysate, with clear single band around 60 kd.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: heart lysate
FH

Jie (Verified Customer) (01-27-2020)

showed a single band at the correct size with mouse heart tissue section

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse heart tissue
FH

Yan (Verified Customer) (01-03-2020)

We tested this antibody in mouse heart tissue extract. It worked very well and showed a single band around 60kDa.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse heart tissue
Loading...
||
New chat

Able

正在加载,请稍候...