PRDX4 Polyclonal antibody

• 

  WB analysis using 10703-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10703-1-AP (PRDX4 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 10703-1-AP

  WB result of PRDX4 antibody (10703-1-AP; 1:20000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PRDX4 transfected HepG2 cells.

• 

  IP experiment of HepG2 using 10703-1-AP

  IP result of anti-PRDX4 (IP:10703-1-AP, 4ug; Detection:10703-1-AP 1:4000) with HepG2 cells lysate 2040 ug.

• 

  IHC staining of human colon cancer using 10703-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10703-1-AP (PRDX4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 10703-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10703-1-AP (PRDX4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human pancreas cancer using 10703-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 10703-1-AP (PRDX4 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human colon cancer using 10703-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10703-1-AP (PRDX4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HepG2 using 10703-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PRDX4 antibody (10703-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 10703-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human PRDX4 (10703-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer (PF00011-C).

• Featured Product
• KD/KO Validated

PRDX4 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 10703-1-AP

Publications(26)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (3)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

Synonyms

Peroxiredoxin IV, peroxiredoxin 4, EC:1.11.1.24, AOE37-2, AOE37 2

---

Tested Applications

• Positive WB detected in: A375 cells, HepG2 cells, HEK-293 cells
• Positive IP detected in: HepG2 cells
• Positive IHC detected in: human colon cancer tissue, human pancreas cancer tissue, human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 5 publications below
• WB: See 24 publications below
• IHC: See 5 publications below
• IF: See 7 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

10703-1-AP targets PRDX4 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1177

  Product name: Recombinant human PRDX4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-271 aa of BC007107

  Sequence: MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN

• Full Name: peroxiredoxin 4
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC007107
• Gene Symbol: PRDX4
• Gene ID (NCBI): 10549
• RRID: AB_2168493
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13162
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PRDX4 (Peroxiredoxin-4) is also named as AOE37-2, Prx-IV and belongs to the AhpC/TSA family. PRDX4 is associated with acrosome formation during rat spermatogenesis and has a protective role in the male reproductive tract, because the phenotype of mice lacking this isoform includes testicular atrophy and increased sperm DNA damage (PMID:20864641). It is initially synthesized as a membrane-binding 31-kDa protein and processed into a 27-kDa secretory form and is discarded with the residual bodies (PMID:19208552). PRDX4 is a pentamer of dimers (PMID:23025503). This antibody is specific to PRDX4.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Nat Commun; Inhibited peroxidase activity of peroxiredoxin 1 by palmitic acid exacerbates nonalcoholic steatohepatitis in male mice; Authors - Wen Yin
human	WB,IP	Nat Commun; The deubiquitinase OTUD1 regulates immunoglobulin production and proteasome inhibitor sensitivity in multiple myeloma; Authors - Alexander Vdovin
rat	WB	Br J Pharmacol; Luteolin ameliorates rat myocardial ischemia-reperfusion injury through peroxiredoxin II activation.; Authors - Bo Wei
human	WB	Antioxid Redox Signal; Pro-Apoptotic Effects of JDA-202, a Novel Natural Diterpenoid, on Esophageal Cancer Through Targeting Peroxiredoxin I.; Authors - Xiao-Jing Shi
human	WB	Antioxid Redox Signal; Direct Proteomic Mapping of Cysteine Persulfidation.; Authors - Ling Fu
mouse	WB	Bioorg Chem; Novel [1,2,3]triazolo[4,5-d]pyrimidine derivatives containing hydrazone fragment as potent and selective anticancer agents.; Authors - Chenhao Xu