Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PPP2CA Polyclonal antibody

PPP2CA Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

EC:3.1.3.16, PP2A alpha, PP2A-alpha, PP2Ac, PP2CA

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PPP2CA in ?

Tested Applications

Positive WB detected inHEK-293T cells, human liver tissue, Jurkat cells, MCF-7 cells
Positive IP detected inJurkat cells
Positive IHC detected inmouse liver tissue, rat liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

13482-1-AP targets PPP2CA in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag4294

Product name: Recombinant human PPP2CA protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-309 aa of BC031696

Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL

Predict reactive species
Full Name protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
Calculated Molecular Weight 309 aa, 36 kDa
Observed Molecular Weight 36-40 kDa
GenBank Accession NumberBC031696
Gene Symbol PPP2CA
Gene ID (NCBI) 5515
RRIDAB_2169485
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP67775
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future.

Protocols

Product Specific Protocols
FC protocol for PPP2CA antibody 13482-1-APDownload protocol
IF protocol for PPP2CA antibody 13482-1-APDownload protocol
IHC protocol for PPP2CA antibody 13482-1-APDownload protocol
IP protocol for PPP2CA antibody 13482-1-APDownload protocol
WB protocol for PPP2CA antibody 13482-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-PPP2CA (PP2Aα) Polyclonal Antibody (Cat# 13482-1-AP) has 58 citations across journals including Science, Cell Research, Molecular Cell, EMBO Journal, Cell Reports, Oncogene, and PLoS Biology. Research fields span cancer biology (hepatocellular, colorectal, breast, gastric), cardiovascular disease, neurodegeneration (Alzheimer's), metabolic regulation (AMPK, insulin resistance), immunology, fibrosis, autophagy, and cell signaling pathways.

SpeciesApplicationTitle
mouseWB

Science

Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.

Authors - Hai Zheng
humanWB,IP

Cell Res

Nuclear UHRF1 is a gate-keeper of cellular AMPK activity and function.

Authors - Xiang Xu
  • KD Validated
humanWB,IHC

Drug Resist Updat

RCN2 facilitates esophageal squamous cellular carcinoma metastasis and cisplatin resistance through UBR5-mediated PPP2CA ubiquitination and degradation.

Authors - Mengyuan Wu
  • KD Validated
mouseWB

Protein Cell

Senktide blocks aberrant RTN3 interactome to retard memory decline and tau pathology in social isolated Alzheimer's disease mice

Authors - He-Zhou Huang
humanIP

Redox Biol

Sustained IKKβ phosphorylation and NF-κB activation by superoxide-induced peroxynitrite-mediated nitrotyrosine modification of B56γ3 and PP2A inactivation.

Authors - Yi Hui Yee
mouse

Mol Cell

Histone phosphorylation integrates the hepatic glucagon-PKA-CREB gluconeogenesis program in response to fasting

Authors - Yongxu Zhao

Reviews

    5.0 out of 5
Add a review

1 verified customer reviews

What customers say

One reviewer rated this antibody 5/5 for Western Blot at a 1:1000 dilution on HEK293 cells. They reported that while some nonspecific bands appeared at various molecular weights, the PPP2CA signal was distinctly specific. They also noted a clear reduction in PPP2CA signal upon targeted degradation, confirming the antibody's reliability for detecting protein knockdown.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


JIN-FENG (Verified Customer) (10-17-2025)

The antibody performs well overall. Despite the presence of multiple nonspecific bands across various molecular weights, the signal for PPP2CA is distinctly specific. Notably, I observe a clear reduction in PPP2CA signal upon targeted degradation.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: HEK293 cell line
PPP2CA Antibody Western Blot validation (1:1000 dilution) in HEK293 cell line (Cat no:13482-1-AP)
Loading...
||
New chat

Able™

正在加载,请稍候...