Tested Applications
| Positive WB detected in | HEK-293T cells, human liver tissue, Jurkat cells, MCF-7 cells |
| Positive IP detected in | Jurkat cells |
| Positive IHC detected in | mouse liver tissue, rat liver tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
| Positive FC (Intra) detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
13482-1-AP targets PPP2CA in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4294 Product name: Recombinant human PPP2CA protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-309 aa of BC031696 Sequence: MDEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHVTRRTPDYFL Predict reactive species |
| Full Name | protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform |
| Calculated Molecular Weight | 309 aa, 36 kDa |
| Observed Molecular Weight | 36-40 kDa |
| GenBank Accession Number | BC031696 |
| Gene Symbol | PPP2CA |
| Gene ID (NCBI) | 5515 |
| RRID | AB_2169485 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P67775 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPP2CA, also named as RP-C and PP2A-alpha, belongs to the PPP phosphatase family and PP-1 subfamily. PP2A can modulate the activity of phosphorylase B kinase casein kinase 2, mitogen-stimulated S6 kinase, and MAP-2 kinase. PP2A activity was modestly decreased in AML patients harboring C-KIT/WT.PP2A is a target for C-KIT/TKD and implicated the potential efficacy of therapies targeting PP2A in such AML in future.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| IF protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| IHC protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| IP protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| WB protocol for PPP2CA antibody 13482-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-PPP2CA (PP2Aα) Polyclonal Antibody (Cat# 13482-1-AP) has 58 citations across journals including Science, Cell Research, Molecular Cell, EMBO Journal, Cell Reports, Oncogene, and PLoS Biology. Research fields span cancer biology (hepatocellular, colorectal, breast, gastric), cardiovascular disease, neurodegeneration (Alzheimer's), metabolic regulation (AMPK, insulin resistance), immunology, fibrosis, autophagy, and cell signaling pathways.
| Species | Application | Title |
|---|---|---|
Science Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase. | ||
Cell Res Nuclear UHRF1 is a gate-keeper of cellular AMPK activity and function.
| ||
Drug Resist Updat RCN2 facilitates esophageal squamous cellular carcinoma metastasis and cisplatin resistance through UBR5-mediated PPP2CA ubiquitination and degradation.
| ||
Protein Cell Senktide blocks aberrant RTN3 interactome to retard memory decline and tau pathology in social isolated Alzheimer's disease mice | ||
Redox Biol Sustained IKKβ phosphorylation and NF-κB activation by superoxide-induced peroxynitrite-mediated nitrotyrosine modification of B56γ3 and PP2A inactivation. | ||
Mol Cell Histone phosphorylation integrates the hepatic glucagon-PKA-CREB gluconeogenesis program in response to fasting |
Reviews
What customers say
One reviewer rated this antibody 5/5 for Western Blot at a 1:1000 dilution on HEK293 cells. They reported that while some nonspecific bands appeared at various molecular weights, the PPP2CA signal was distinctly specific. They also noted a clear reduction in PPP2CA signal upon targeted degradation, confirming the antibody's reliability for detecting protein knockdown.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
JIN-FENG (Verified Customer) (10-17-2025) | The antibody performs well overall. Despite the presence of multiple nonspecific bands across various molecular weights, the signal for PPP2CA is distinctly specific. Notably, I observe a clear reduction in PPP2CA signal upon targeted degradation.
 |
