Tested Applications
| Positive WB detected in | HEK-293 cells, HEK-293T cells, L02 cells, MCF-7 cells, mouse brain tissue, rat brain tissue |
| Positive IP detected in | HEK-293 cells |
| Positive IHC detected in | human pancreas cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HEK-293 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11082-1-AP targets PPP1CC in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1550 Product name: Recombinant human PPP1CC protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-323 aa of BC014073 Sequence: MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK Predict reactive species |
| Full Name | protein phosphatase 1, catalytic subunit, gamma isoform |
| Calculated Molecular Weight | 35 kDa |
| Observed Molecular Weight | 35 kDa |
| GenBank Accession Number | BC014073 |
| Gene Symbol | PPP1CC |
| Gene ID (NCBI) | 5501 |
| RRID | AB_2168085 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P36873 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for PPP1CC antibody 11082-1-AP | Download protocol |
| IHC protocol for PPP1CC antibody 11082-1-AP | Download protocol |
| IP protocol for PPP1CC antibody 11082-1-AP | Download protocol |
| WB protocol for PPP1CC antibody 11082-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-PP1γ (PPP1CC) antibody, Cat# 11082-1-AP, has 15 citations across journals including Molecular Cell, Cell Death & Disease, Developmental Cell, EMBO Journal, Cell Reports, European Journal of Pharmacology, iScience, FASEB Journal, and Journal of Biological Chemistry. Research fields span splicing regulation, cardiomyopathy, cancer (osteosarcoma, glioblastoma, breast cancer), mitochondrial inflammation, DNA damage response, stem cell differentiation, and innate immunity.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Direct conversion of human umbilical cord mesenchymal stem cells into retinal pigment epithelial cells for treatment of retinal degeneration | ||
Cell Death Dis Protein phosphatase 1 regulatory subunit 15 A promotes translation initiation and induces G2M phase arrest during cuproptosis in cancers | ||
Dev Cell Loss of RanGAP1 drives chromosome instability and rapid tumorigenesis of osteosarcoma
| ||
EMBO J Mitochondrial outer membrane integrity regulates a ubiquitin-dependent and NF-κB-mediated inflammatory response | ||
Reviews
What customers say
There is one user review for this product, rated 3 out of 5, posted in August 2018. The reviewer used the antibody for flow cytometry. No detailed written comments were provided in the review.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Jua (Verified Customer) (08-01-2018) |
|
