Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

PPP1CC Polyclonal antibody

PPP1CC Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

EC:3.1.3.16, PP-1G, Serine/threonine-protein phosphatase PP1-gamma catalytic subunit

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for PPP1CC in ?

Tested Applications

Positive WB detected inHEK-293 cells, HEK-293T cells, L02 cells, MCF-7 cells, mouse brain tissue, rat brain tissue
Positive IP detected inHEK-293 cells
Positive IHC detected inhuman pancreas cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

11082-1-AP targets PPP1CC in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1550

Product name: Recombinant human PPP1CC protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-323 aa of BC014073

Sequence: MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Predict reactive species
Full Name protein phosphatase 1, catalytic subunit, gamma isoform
Calculated Molecular Weight 35 kDa
Observed Molecular Weight 35 kDa
GenBank Accession NumberBC014073
Gene Symbol PPP1CC
Gene ID (NCBI) 5501
RRIDAB_2168085
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP36873
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PPP1CC, also named as PP-1G, belongs to the PPP phosphatase family and PP-1 subfamily. Protein phosphatase 1 (PP1) is essential for cell division, and participates in the regulation of glycogen metabolism, muscle contractility and protein synthesis. It is involved in regulation of ionic conductances and long-term synaptic plasticity. PPP1CC may play an important role in dephosphorylating substrates such as the postsynaptic density-associated Ca2+/calmodulin dependent protein kinase II.

Protocols

Product Specific Protocols
IF protocol for PPP1CC antibody 11082-1-APDownload protocol
IHC protocol for PPP1CC antibody 11082-1-APDownload protocol
IP protocol for PPP1CC antibody 11082-1-APDownload protocol
WB protocol for PPP1CC antibody 11082-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-PP1γ (PPP1CC) antibody, Cat# 11082-1-AP, has 15 citations across journals including Molecular Cell, Cell Death & Disease, Developmental Cell, EMBO Journal, Cell Reports, European Journal of Pharmacology, iScience, FASEB Journal, and Journal of Biological Chemistry. Research fields span splicing regulation, cardiomyopathy, cancer (osteosarcoma, glioblastoma, breast cancer), mitochondrial inflammation, DNA damage response, stem cell differentiation, and innate immunity.

SpeciesApplicationTitle

Mol Cell

Thermo-sensing mechanisms of splicing control by nuclear stress bodies.

Authors - Tsuyoshi Ueno
humanWB

Cell Death Dis

Direct conversion of human umbilical cord mesenchymal stem cells into retinal pigment epithelial cells for treatment of retinal degeneration

Authors - Xiaoman Zhu
humanWB

Cell Death Dis

Protein phosphatase 1 regulatory subunit 15 A promotes translation initiation and induces G2M phase arrest during cuproptosis in cancers

Authors - Chunyu Liu
mouse,humanWB,IP

Dev Cell

Loss of RanGAP1 drives chromosome instability and rapid tumorigenesis of osteosarcoma

Authors - Yan Gong
  • KD Validated

EMBO J

Mitochondrial outer membrane integrity regulates a ubiquitin-dependent and NF-κB-mediated inflammatory response

Authors - Esmee Vringer

Cell Rep

A non-catalytic function for RAD18 in sustaining glioblastoma proliferation.

Authors - Nour Benbahouche

Reviews

    3.0 out of 5
Add a review

1 verified customer reviews

What customers say

There is one user review for this product, rated 3 out of 5, posted in August 2018. The reviewer used the antibody for flow cytometry. No detailed written comments were provided in the review.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Jua (Verified Customer) (08-01-2018)

  • Applications: Flow Cytometry,
  • Primary Antibody Dilution: Souris têtard isralien
Loading...
||
New chat

Able™

正在加载,请稍候...