• Featured Product
  • KD/KO Validated

PPAR Gamma Polyclonal antibody

PPAR Gamma Polyclonal Antibody for WB, IHC, ELISA
Cat No. 22061-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

PPARG, NR1C3, Peroxisome proliferator-activated receptor gamma, PPAR-gamma, PPARγ

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, human brain tissue, human heart tissue, mouse ovary tissue, mouse heart tissue, mouse testis tissue, mouse liver tissue, MCF-7 cells, 3T3-L1 cells, rat brain tissue, HL-60 cells, mouse brain tissue, rat liver tissue
Positive IHC detected inhuman prostate cancer tissue, human colon cancer tissue, rat colon tissue, human placenta tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22061-1-AP targets PPAR Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag17136

Product name: Recombinant human PPARG protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-111 aa of BC006811

Sequence: MTMVDTEMPFWPTNFGISSVDLSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIEC

Predict reactive species
Full Name peroxisome proliferator-activated receptor gamma
Calculated Molecular Weight 505 aa, 58 kDa
Observed Molecular Weight 66-70 kDa
GenBank Accession NumberBC006811
Gene Symbol PPARG
Gene ID (NCBI) 5468
RRIDAB_11182268
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP37231
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Peroxisome Proliferator-Activated Receptors (PPARs) are ligand-activated intracellular transcription factors, members of the nuclear hormone receptor superfamily (NR), that includes estrogen, thyroid hormone receptors, retinoic acid, Vitamin D3 as well as retinoid X receptors (RXRs). The PPAR subfamily consists of three subtypes encoded by distinct genes denoted PPARα (NR1C1), PPARβ/δ (NR1C2) and PPARγ (NR1C3), which are activated by selective ligands. PPARγ, also named as PPARG, contains one nuclear receptor DNA-binding domain and is a receptor that binds peroxisome proliferators such as hypolipidemic drugs and fatty acids. It plays an important role in the regulation of lipid homeostasis, adipogenesis, INS resistance, and development of various organs. Defects in PPARG are the cause of familial partial lipodystrophy type 3 (FPLD3) and may be associated with susceptibility to obesity. Defects in PPARG can lead to type 2 INS-resistant diabetes and hypertension. PPARG mutations may be associated with colon cancer. Genetic variations in PPARG are associated with susceptibility to glioma type 1 (GLM1). PPARG has two isoforms with molecular weight 57 kDa and 54 kDa (PMID: 9831621), but modified PPARG is about 67 KDa (PMID: 16809887). PPARG2 is a splice variant and has an additional 30 amino acids at the N-terminus (PMID: 15689403). Experimental data indicate that a 45 kDa protein displaying three different sequences immunologically related to the nuclear receptor PPARG2 is located in mitochondria (mt-PPAR). However, the molecular weight of this protein is clearly less when compared to that of PPARG2 (57 kDa). (PMID: 10922459). PPARG has been reported to be localized mainly (but not always) in the nucleus. PPARG can also be detected in the cytoplasm and was reported to possess extra-nuclear/non-genomic actions (PMID: 17611413; 19432669; 14681322).

Publications

SpeciesApplicationTitle
mouseWB

Autophagy

Mir223 restrains autophagy and promotes CNS inflammation by targeting ATG16L1.

Authors - Yan Li
mouseWB

Genes Dev

Loss of TLE3 promotes the mitochondrial program in beige adipocytes and improves glucose metabolism.

Authors - Stephanie Pearson
mouseWB

Free Radic Biol Med

Hydrogen sulfide alleviates particulate matter-induced emphysema and airway inflammation by suppressing ferroptosis.

Authors - Ying Wang
mouseWB

Biochem Pharmacol

A novel pyrazole-containing indolizine derivative suppresses NF-κB activation and protects against TNBS-induced colitis via a PPAR-γ-dependent pathway.

Authors - Yong Fu

Front Pharmacol

The Active Components of Fuzheng Huayu Formula and Their Potential Mechanism of Action in Inhibiting the Hepatic Stellate Cells Viability - A Network Pharmacology and Transcriptomics Approach.

Authors - Xinrui Xing
ratWB

Front Pharmacol

Alpha-Asaronol Alleviates Dysmyelination by Enhancing Glutamate Transport Through the Activation of PPARγ-GLT-1 Signaling in Hypoxia-Ischemia Neonatal Rats.

Authors - Yuhang Ge
Loading...
||
New chat

Able

正在加载,请稍候...