uPA/Urokinase Polyclonal antibody

• 

  WB analysis using 17968-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 17968-1-AP (uPA/Urokinase antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 17968-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 17968-1-AP (uPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A375 using 17968-1-AP

  A375 cells were subjected to SDS PAGE followed by western blot with 17968-1-AP (uPA antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 17968-1-AP

  IP result of anti-uPA/Urokinase (IP:17968-1-AP, 4ug; Detection:17968-1-AP 1:1000) with HeLa cells lysate 2800ug.

• 

  IHC staining of human breast cancer using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17968-1-AP (uPA/Urokinase antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 17968-1-AP (uPA/Urokinase antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human bowen disease using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human bowen disease slide using 17968-1-AP (uPA/Urokinase antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17968-1-AP (uPA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human skin using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 17968-1-AP (uPA antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17968-1-AP (uPA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human lung using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 17968-1-AP (uPA antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human ovary using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17968-1-AP (uPA antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human ovary using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary using 17968-1-AP (uPA antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human prostate cancer using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 17968-1-AP (uPA/Urokinase antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human prostate cancer using 17968-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 17968-1-AP (uPA/Urokinase antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 17968-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using uPA/Urokinase antibody (17968-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2).

• Featured Product
• KD/KO Validated

uPA/Urokinase Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 17968-1-AP

Publications(49)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PLAU, UPA, ATF, EC:3.4.21.73, u PA

---

Tested Applications

• Positive WB detected in: DU 145 cells, human brain tissue, A375 cells, Hela cells, LNCaP cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, human bowen disease, human lung tissue, human ovary tissue, human prostate cancer tissue, human skin tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 38 publications below
• IHC: See 12 publications below
• IF: See 7 publications below
• IP: See 1 publications below
• CoIP: See 1 publications below

Product Information

17968-1-AP targets uPA/Urokinase in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, bovine
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11813

  Product name: Recombinant human uPA protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 82-431 aa of BC013575

  Sequence: ASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKPLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL

• Full Name: plasminogen activator, urokinase
• Calculated Molecular Weight: 431 aa, 49 kDa
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC013575
• Gene Symbol: Urokinase
• Gene ID (NCBI): 5328
• RRID: AB_2165202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P00749
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PLAU(Urokinase-type plasminogen activator) is also named as uPA and belongs to the peptidase S1 family.UPA initiates a proteolytic cascade, which degrades extracellular matrix during tissue growth and remodelling.The secreted proform of UPA is activated after binding to a specific high affinity cell surface receptor. Secreted UPA is exposed to rapid inactivation in the pericellular space by plasminogen activator inhibitor-1 (PAI-1), which is stored in the extracellular matrix bound to vitronectin(PMID:9665342).It has 2 isoforms produced by alternative splicing. Defects in PLAU are the cause of Quebec platelet disorder (QPD).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Sci Adv; p53 loss activates prometastatic secretory vesicle biogenesis in the Golgi.; Authors - Xiaochao Tan
mouse	WB	Gastroenterology; Inhibition of Plasmin Protects Against Colitis in Mice by Suppressing Matrix Metalloproteinase 9-mediated Cytokine Release From Myeloid Cells.; Authors - Shinya Munakata
mouse	WB,IF	J Exp Med; PDGF-D activation by macrophage-derived uPA promotes AngII-induced cardiac remodeling in obese mice.; Authors - Yu-Wen Cheng
human	IHC	Aging (Albany NY); Tertiary lymphoid structure stratifies glioma into three distinct tumor subtypes.; Authors - Xingwang Zhou
mouse	WB	Angiogenesis; PDGFD switches on stem cell endothelial commitment.; Authors - Weisi Lu
human	WB	Aging (Albany NY); NFAT5 directs hyperosmotic stress-induced fibrin deposition and macrophage infiltration via PAI-1 in endothelium.; Authors - Pingping Ma