PI3 Kinase p110 Gamma Polyclonal antibody

• 

  WB analysis using 31229-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31229-1-AP (PIK3CG antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 31229-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 31229-1-AP (PIK3CG antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PI3 Kinase p110 Gamma Polyclonal Antibody for WB, IHC, ELISA

Cat No. 31229-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

PIK3CG, EC:2.7.1.137, EC:2.7.11.1, p110gamma, p120 PI3K

---

Tested Applications

• Positive WB detected in: K-562 cells, mouse spleen tissue, mouse thymus tissue
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31229-1-AP targets PI3 Kinase p110 Gamma in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34951

  Product name: Recombinant human PIK3CG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 305-482 aa of BC035683

  Sequence: VVLDTPPDPALDEVRKEEWPLVDDCTGVTGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNTDLTVFVEANIQHGQQVLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPKGALLNLQIYCGKAPALSSKASAESPSSESKGKVQLLYYVNLLLIDHRFLLRRGEYVL

• Full Name: phosphoinositide-3-kinase, catalytic, gamma polypeptide
• Calculated Molecular Weight: 126 kDa
• Observed Molecular Weight: 126 kDa
• GenBank Accession Number: BC035683
• Gene Symbol: PIK3CG
• Gene ID (NCBI): 5294
• RRID: AB_3669910
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P48736
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.