PFKFB2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85639-6-RR (same clone as 85639-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85639-6-RR (PFKFB2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85639-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85639-6-RR

  Biolayer interferometry (BLl) kinetic assays of 85639-6-RR against Human PFKFB2 were performed. The affinity constant is 2.74 nM.

PFKFB2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85639-6-PBS

Clone No.243136E5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

6PF-2-K/Fru-2,6-P2ase 2, 6PF-2-K/Fru-2,6-P2ase heart-type isozyme, 6-phosphofructo-2-kinase, 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2, Fructose-2,6-bisphosphatase

---

Product Information

85639-6-PBS targets PFKFB2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32347

  Product name: Recombinant human PFKFB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-505 aa of BC075076

  Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD

• Full Name: 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2
• Calculated Molecular Weight: 505 aa, 58 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC075076
• Gene Symbol: PFKFB2
• Gene ID (NCBI): 5208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60825
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PFKFB2(6-Phosphofructo-2-kinase/fructose 2,6-bisphosphatase 2) is also named as PFK-2/FBPase-2, which is a bifunctional enzyme responsible for the synthesis and breakdown of Fru-2,6-P2 in the regulation of glycolysis(PMID:10095107). In the C-terminal section, it belongs to the phosphoglycerate mutase family. The enzyme is a dimer of identical subunits, each composed of 505 amino acids and containing three discrete domains(PMID: 2552438). It has 2 isoforms produced by alternative splicing.