Product Information
85639-2-PBS targets PFKFB2 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag32347 Product name: Recombinant human PFKFB2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-505 aa of BC075076 Sequence: CKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD Predict reactive species |
| Full Name | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 |
| Calculated Molecular Weight | 505 aa, 58 kDa |
| GenBank Accession Number | BC075076 |
| Gene Symbol | PFKFB2 |
| Gene ID (NCBI) | 5208 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | O60825 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
