P53 Monoclonal antibody

• 

  WB analysis of NIH/3T3 using 60283-1-Ig

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 60283-1-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of RAW 264.7 using 60283-1-Ig

  RAW 264.7 cells were subjected to SDS PAGE followed by western blot with 60283-1-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 60283-1-Ig

  A431 cells were subjected to SDS PAGE followed by western blot with 60283-1-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 60283-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 60283-1-Ig (P53 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 60283-1-Ig

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 60283-1-Ig (P53 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of COLO 320 using 60283-1-Ig

  COLO 320 cells were subjected to SDS PAGE followed by western blot with 60283-1-Ig (P53 Antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary tumor using 60283-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-1-Ig (P53 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human ovary tumor using 60283-1-Ig

  Immunohistochemical analysis of paraffin-embedded human ovary tumor tissue slide using 60283-1-Ig (P53 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

This P53 antibody (60283-1-Ig) is a mouse monoclonal antibody that targets P53 in ELISA and is suitable for human, mouse, rat samples. The 60283-1-Ig antibody has 29 publication citations.

Cat No. 60283-1-Ig

Clone No.2D2F10

Publications(29)

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Antigen NY CO 13, Cellular tumor antigen p53, LFS1, Phosphoprotein p53, TRP53, tumor protein p53, Tumor suppressor p53

---

Published Applications

• KD/KO: See 2 publications below
• WB: See 27 publications below
• IHC: See 1 publications below
• IF: See 1 publications below
• IP: See 1 publications below

Product Information

60283-1-Ig targets P53 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0698

  Product name: Recombinant human P53 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-232 aa of BC003596

  Sequence: MEEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIEQWFTEDPGPDEAPRMPEAAPRVAPAPAAPTPAAPAPAPSWPLSSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQHMTEVVRRCPHHERCSDSDGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTI

• Full Name: tumor protein p53
• Calculated Molecular Weight: 44 kDa
• GenBank Accession Number: BC003596
• Gene Symbol: P53
• Gene ID (NCBI): 7157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P04637
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

TP53, also named as P53 and NY-CO-13, belongs to the p53 family. It has 9 isoforms. In SDS-Page, the MW is about 53kd. TP53 acts as a tumor suppressor in many tumor types; induces growth arrest or apoptosis depending on the physiological circumstances and cell type. It is involved in cell cycle regulation as a trans-activator that acts to negatively regulate cell division by controlling a set of genes required for this process. The antibody reacts specifically with 53 kDa protein.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Mol Ther Nucleic Acids; miR-552 Regulates Liver Tumor-Initiating Cell Expansion and Sorafenib Resistance.; Authors - Tao Han
human	WB	Oncogenesis; MeCP2 facilitates breast cancer growth via promoting ubiquitination-mediated P53 degradation by inhibiting RPL5/RPL11 transcription.; Authors - DongDong Tong
human	WB,IHC	Cancer Lett; TAZ regulates cell proliferation and sensitivity to vitamin D3 in intrahepatic cholangiocarcinoma.; Authors - Heng Xiao ; KD Validated
human,mouse	WB	Am J Cancer Res; Asparaginyl endopeptidase (AEP) regulates myocardial apoptosis in response to radiation exposure via alterations in NRF2 activation.; Authors - Lu Cao
human	WB	Am J Cancer Res; Loss of BRMS2 induces cell growth inhibition and translation capacity reduction in colorectal cancer cells.; Authors - Yaofu Liu
human	WB	Biochem Pharmacol; Ketoplatin in triple-negative breast cancer cells MDA-MB-231: High efficacy and low toxicity, and positive impact on inflammatory microenvironment.; Authors - Zhong-Ying Ma