Filter: AllWBIHCIF-P

WB analysis using 67654-1-Ig (same clone as 67654-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 67654-1-Ig (P2RY1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
×
Various lysates were subjected to SDS PAGE followed by western blot with 67654-1-Ig (P2RY1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67654-1-Ig (same clone as 67654-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IHC staining of mouse brain using 67654-1-Ig (same clone as 67654-1-PBS)
Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 67654-1-Ig (same clone as 67654-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IHC staining of human placenta using 67654-1-Ig (same clone as 67654-1-PBS)
Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 67654-1-Ig (P2RY1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IF Staining of rat brain using 67654-1-Ig (same clone as 67654-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IF Staining of rat brain using 67654-1-Ig (same clone as 67654-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed rat brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 67654-1-Ig (same clone as 67654-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.
IF Staining of mouse brain using 67654-1-Ig (same clone as 67654-1-PBS)
Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using P2RY1 antibody (67654-1-Ig, Clone: 1A1F3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67654-1-PBS in a different storage buffer formulation.

P2RY1 Monoclonal antibody, PBS Only

P2RY1 Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 67654-1-PBS

Clone No.1A1F3

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF-P, ELISA

Synonyms

ADP receptor, ATP receptor, P2Y purinoceptor 1, P2Y1, Purinergic receptor

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

67654-1-PBS targets P2RY1 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity	human, mouse, rat, pig, rabbit
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag12762 Product name: Recombinant human P2RY1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 281-373 aa of BC074785 Sequence: TMNLRARLDFQTPAMCAFNDRVYATYQVTRGLASLNSCVDPILYFLAGDTFRRRLSRATRKASRRSEANLQSKSEDMTLNILPEFKQNGDTSL Predict reactive species
Full Name	purinergic receptor P2Y, G-protein coupled, 1
Calculated Molecular Weight	373 aa, 42 kDa
Observed Molecular Weight	55 kDa
GenBank Accession Number	BC074785
Gene Symbol	P2RY1
Gene ID (NCBI)	5028
RRID	AB_2882853
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein G purification
UNIPROT ID	P47900
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.