Tested Applications
| Positive WB detected in | HUVEC cells, Jurkat cells, mouse colon tissue, LNCaP cells, U2OS cells, pig colon tissue, rat colon tissue, 4T1 cells, HEK-293 cells |
| Positive IHC detected in | human lung cancer tissue, mouse kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
66378-1-Ig targets Occludin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse, rat, pig, canine, bovine, sheep |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag4057 Product name: Recombinant human Occludin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 270-522 aa of BC029886 Sequence: KMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT Predict reactive species |
| Full Name | occludin |
| Calculated Molecular Weight | 522 aa, 59 kDa |
| Observed Molecular Weight | 59 kDa |
| GenBank Accession Number | BC029886 |
| Gene Symbol | Occludin |
| Gene ID (NCBI) | 4950 |
| RRID | AB_2881755 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q16625 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Occludin antibody 66378-1-Ig | Download protocol |
| IHC protocol for Occludin antibody 66378-1-Ig | Download protocol |
| WB protocol for Occludin antibody 66378-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Occludin (OCLN) antibody (Cat# 66378-1-Ig) has accumulated 221 citations across journals including Nature Communications, Advanced Science, Autophagy, Phytomedicine, Journal of Ethnopharmacology, International Journal of Molecular Sciences, Cell Reports, Science Advances, and Frontiers in Pharmacology. Key research fields include intestinal epithelial barrier dysfunction, blood-brain barrier disruption, tight junction biology, inflammatory bowel disease, gut microbiota modulation, neuroinflammation, ferroptosis, and cardiovascular diseases.
| Species | Application | Title |
|---|---|---|
Autophagy Streptococcus pneumoniae extracellular vesicles aggravate alveolar epithelial barrier disruption via autophagic degradation of OCLN (occludin) | ||
Autophagy High-fat diet exacerbates experimental colitis by inhibiting lysosomal function via the STAT3-TFEB Axis. | ||
J Adv Res Sedanolide alleviated DSS-induced colitis by modulating the intestinal FXR-SMPD3 pathway in mice | ||
Cardiovasc Diabetol Pgk1 activation restores endothelial metabolic homeostasis to alleviate vascular aging and atherosclerosis. |
Reviews
What customers say
All three reviewers used this antibody for Western Blot and reported positive results. One user praised its performance in detecting the target in mouse vaginal tissue at 1:1000 dilution. Another highlighted the clear, specific band quality on membranes. A third found it satisfactory for use with an automated Western Blot system (Protein Simple Wes) at 1/400 dilution on Caco-2 cells. Overall, users are satisfied with its specificity and reliability across both manual and automated WB workflows.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Ipsita (Verified Customer) (07-14-2026) | Worked great for detection in mouse tissue
|
Saba (Verified Customer) (07-25-2022) | The quality of the band is very good and you can easily find the specific band on your membrane.
|
Doriane (Verified Customer) (08-25-2019) | Satisfying antibody used for automated Western-blot Wes (Protein Simple)
|





















