Use Able AI chat for product recommendations
  • Featured Product
  • KD/KO Validated

Occludin Monoclonal antibody

Occludin Monoclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 66378-1-Ig
Clone No. 1D3C4
Publications (221)
Reviews (3)
Download datasheet

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig and More (3)

Applications

WB, IHC, IF/ICC, ELISA

OCLN, 1D3C4

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:

Able AI
Able AI
What's the best dilution for Occludin in ?

Tested Applications

Positive WB detected inHUVEC cells, Jurkat cells, mouse colon tissue, LNCaP cells, U2OS cells, pig colon tissue, rat colon tissue, 4T1 cells, HEK-293 cells
Positive IHC detected inhuman lung cancer tissue, mouse kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66378-1-Ig targets Occludin in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse, rat, pig, canine, bovine, sheep
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag4057

Product name: Recombinant human Occludin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 270-522 aa of BC029886

Sequence: KMDRYDKSNILWDKEHIYDEQPPNVEEWVKNVSAGTQDVPSPPSDYVERVDSPMAYSSNGKVNDKRFYPESSYKSTPVPEVVQELPLTSPVDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

Predict reactive species
Full Name occludin
Calculated Molecular Weight 522 aa, 59 kDa
Observed Molecular Weight 59 kDa
GenBank Accession NumberBC029886
Gene Symbol Occludin
Gene ID (NCBI) 4950
RRIDAB_2881755
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ16625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Protocols

Product Specific Protocols
IF protocol for Occludin antibody 66378-1-IgDownload protocol
IHC protocol for Occludin antibody 66378-1-IgDownload protocol
WB protocol for Occludin antibody 66378-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

What published studies show

Anti-Occludin (OCLN) antibody (Cat# 66378-1-Ig) has accumulated 221 citations across journals including Nature Communications, Advanced Science, Autophagy, Phytomedicine, Journal of Ethnopharmacology, International Journal of Molecular Sciences, Cell Reports, Science Advances, and Frontiers in Pharmacology. Key research fields include intestinal epithelial barrier dysfunction, blood-brain barrier disruption, tight junction biology, inflammatory bowel disease, gut microbiota modulation, neuroinflammation, ferroptosis, and cardiovascular diseases.

SpeciesApplicationTitle
mouseIF

Autophagy

Streptococcus pneumoniae extracellular vesicles aggravate alveolar epithelial barrier disruption via autophagic degradation of OCLN (occludin)

Authors - Luqing Cui
humanIF

Autophagy

High-fat diet exacerbates experimental colitis by inhibiting lysosomal function via the STAT3-TFEB Axis.

Authors - Haodong He
mouseWB

Nat Commun

The gut microbe Bacteroides fragilis ameliorates renal fibrosis in mice

Authors - Wei Zhou
humanIF

Circ Res

Endothelial BACE1 Impairs Cerebral Small Vessels via Tight Junctions and eNOS.

Authors - Haoyue Zhou
mouseIHC,IF

J Adv Res

Sedanolide alleviated DSS-induced colitis by modulating the intestinal FXR-SMPD3 pathway in mice

Authors - Shengjie Li
mouse,humanWB

Cardiovasc Diabetol

Pgk1 activation restores endothelial metabolic homeostasis to alleviate vascular aging and atherosclerosis.

Authors - Jinhong Lu

Reviews

    4.3 out of 5
Add a review

3 verified customer reviews

What customers say

All three reviewers used this antibody for Western Blot and reported positive results. One user praised its performance in detecting the target in mouse vaginal tissue at 1:1000 dilution. Another highlighted the clear, specific band quality on membranes. A third found it satisfactory for use with an automated Western Blot system (Protein Simple Wes) at 1/400 dilution on Caco-2 cells. Overall, users are satisfied with its specificity and reliability across both manual and automated WB workflows.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


Ipsita (Verified Customer) (07-14-2026)

Worked great for detection in mouse tissue

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Mouse vaginal column tissue

Saba (Verified Customer) (07-25-2022)

The quality of the band is very good and you can easily find the specific band on your membrane.

  • Applications: Western Blot

Doriane (Verified Customer) (08-25-2019)

Satisfying antibody used for automated Western-blot Wes (Protein Simple)

  • Applications: Western Blot, Other,
  • Primary Antibody Dilution: Automated Western Blot Wes 1/400
  • Cell Tissue Type: Caco-2/TC7 cell line
Loading...
||
New chat

Able™

正在加载,请稍候...