Occludin Polyclonal antibody

Occludin Polyclonal Antibody for WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, ELISA

Cat No. 27260-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (7)

Applications

WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, ELISA

OCLN

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHUVEC cells, A431 cells, mouse kidney tissue, Caco-2 cells, mouse brain tissue, mouse colon tissue, rat colon tissue, rat brain tissue
Positive IP detected inHUVEC cells
Positive IHC detected inhuman colon tissue, human breast cancer tissue, human kidney tissue, mouse colon tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-Fro detected inmouse brain tissue
Positive IF/ICC detected inCaco-2 cells, MCF-7 cells
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:1000-1:10000
Immunofluorescence (IF)-FROIF-FRO : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

27260-1-AP targets Occludin in WB, IHC, IF/ICC, IF-Fro, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, rabbit, canine, chicken, bovine, goat, duck
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag26173

Product name: Recombinant human Occludin protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 360-522 aa of BC029886

Sequence: VDDFRQPRYSSGGNFETPSKRAPAKGRAGRSKRTEQDHYETDYTTGGESCDELEEDWIREYPPITSDQQRQLYKRNFDTGLQEYKSLQSELDEINKELSRLDKELDDYREESEEYMAAADEYNRLKQVKGSADYKSKKNHCKQLKSKLSHIKKMVGDYDRQKT

Predict reactive species
Full Name occludin
Calculated Molecular Weight 522 aa, 59 kDa
Observed Molecular Weight 59 kDa, 53 kDa, 32 kDa, 23-25 kDa
GenBank Accession NumberBC029886
Gene Symbol Occludin
Gene ID (NCBI) 4950
RRIDAB_2880820
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ16625
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Occludin is an integral membrane protein located at the tight junction. It is a tetraspanin protein with four transmembrane domains, intracellular N and C termini, and two extracellular loops. Occludin plays a role in the formation and regulation of the tight junction paracellular permeability barrier. Occludin can exist in different isoforms, owing to modifications at the posttranscriptional and posttranslational levels, the monomeric occludin migrates as 53-65 kDa on SDS-PAGE (PMID: 22083955; 19457074).

Protocols

Product Specific Protocols
FC protocol for Occludin antibody 27260-1-APDownload protocol
IF protocol for Occludin antibody 27260-1-APDownload protocol
IHC protocol for Occludin antibody 27260-1-APDownload protocol
IP protocol for Occludin antibody 27260-1-APDownload protocol
WB protocol for Occludin antibody 27260-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIHC

Cell Metab

Acetate enables metabolic fitness and cognitive performance during sleep disruption

Authors - Qinqin He
mouseIF

J Clin Invest

A20 regulates lymphocyte adhesion in murine neuroinflammation by restricting endothelial ICOSL expression in the CNS

Authors - Lisa Johann
pigWB

Microbiome

Zearalenone disturbs the reproductive-immune axis in pigs: the role of gut microbial metabolites

Authors - Shujin Wang
IF

Microbiome

Arula-7 powder improves diarrhea and intestinal epithelial tight junction function associated with its regulation of intestinal flora in calves infected with pathogenic Escherichia coli O1

Authors - Hao Chen
mouseIF

Adv Sci (Weinh)

Plasma-Activated Solutions Mitigates DSS-Induced Colitis via Restoring Redox Homeostasis and Reversing Microbiota Dysbiosis

Authors - Tuanhe Sun

Neuron

C5aR1+ microglia exacerbate neuroinflammation and cerebral edema in acute brain injury

Authors - Jinpeng Zhou

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Iram (Verified Customer) (06-13-2022)

Excellent antibody for immunoblotting

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: colon cancer cells
FH

Balawant (Verified Customer) (05-08-2022)

This antibody I have used and is working great . 1:2000 dilution is working great for the cell line (Colonic epithelialcellr of human).

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: Human colonic epithelial cells and mice colon tissue
FH

Kushal (Verified Customer) (03-14-2022)

  • Applications: Western Blot, Immunoprecipitation, ChIP
  • Primary Antibody Dilution: 1.2000
  • Cell Tissue Type: Surgical human tissue, mouse tissue, Caco-2 cells
Loading...
||
New chat

Able

正在加载,请稍候...