Neuropilin 1/CD304 Monoclonal antibody

• 

  WB analysis using 60067-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig heart using 60067-1-Ig

  pig heart tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 60067-1-Ig

  HeLa cells were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of rabbit heart using 60067-1-Ig

  rabbit heart tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MDA-MB-231 using 60067-1-Ig

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 60067-1-Ig

  A549 cells were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of fetal human brain using 60067-1-Ig

  fetal human brain tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human plasma using 60067-1-Ig

  human blood were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of pig brain using 60067-1-Ig

  pig brain tissue were subjected to SDS PAGE followed by western blot with 60067-1-Ig (Neuropilin 1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of human embronic stem cells using 60067-1-Ig

  Confocal immunofluorescent analysis of human embronic stem cells with 60067-1-Ig at dilution of 1:100. DAPI was used to stain the cell nuclei (blue) at a concentration of 1ug/ml. This photo is the merge of PE and DAPI. (40X).

• 

  IF Staining of SH-SY5Y using 60067-1-Ig

  Immunofluorescent analysis of (-20℃ Ethanol ) fixed SH-SY5Y cells using 60067-1-Ig(Neuropilin 1 antibody) at dilution of 1:100 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Mouse IgG(H+L).

• Featured Product
• KD/KO Validated

Neuropilin 1/CD304 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 60067-1-Ig

Clone No.2H3F6

Publications(26)

Host / Isotype

Mouse / IgG1

Reactivity

human, pig, rabbit and More (2)

Applications

WB, IF/ICC, IP, CoIP, ELISA

Synonyms

Neuropilin 1, NRP1, 2H3F6, BDCA4, CD304

---

Tested Applications

• Positive WB detected in: human placenta tissue, fetal human brain tissue, human plasma, 37°C incubated human placenta tissue, pig brain tissue, HeLa cells, rabbit heart tissue, MDA-MB-231 cells, A549 cells, pig heart tissue
• Positive IF/ICC detected in: SH-SY5Y cells, human embronic stem cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 15 publications below
• IF: See 10 publications below
• IP: See 2 publications below
• CoIP: See 1 publications below

Product Information

60067-1-Ig targets Neuropilin 1/CD304 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rabbit samples.

• Tested Reactivity: human, pig, rabbit
• Cited Reactivity: human, mouse, rabbit, xenopus
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0931

  Product name: Recombinant human NRP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC007737

  Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN

• Full Name: neuropilin 1
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: BC007737
• Gene Symbol: Neuropilin 1
• Gene ID (NCBI): 8829
• RRID: AB_2150840
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: O14786
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Neuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
Xenopus	IF	Elife; Receptor-specific interactome as a hub for rapid cue-induced selective translation in axons.; Authors - Max Koppers
human	IF	Acta Biomater; Semaphorin-3A, Neuropilin-1 and Plexin-A1 in Prosthetic-Particle Induced Bone Loss.; Authors - S Saad
human		J Pathol; Perivascular Neuropilin-1 expression is an independent marker of improved survival in renal cell carcinoma.; Authors - Eric Morin
human	IF	Am J Cancer Res; CMTM6 promotes cell proliferation and invasion in oral squamous cell carcinoma by interacting with NRP1.; Authors - Yang Zheng
mouse	WB	Pharm Res; Dual Receptor Targeting Cell Penetrating Peptide Modified Liposome for Glioma and Breast Cancer Postoperative Recurrence Therapy.; Authors - Yue Qiu
mouse	IF	Exp Eye Res; Expression of axon guidance ligands and their receptors in the cornea and trigeminal ganglia and their recovery after corneal epithelium injury.; Authors - Victor H Guaiquil