Tested Applications
| Positive WB detected in | human placenta tissue, fetal human brain tissue, human plasma, 37°C incubated human placenta tissue, pig brain tissue, HeLa cells, rabbit heart tissue, MDA-MB-231 cells, A549 cells, pig heart tissue |
| Positive IF/ICC detected in | SH-SY5Y cells, human embronic stem cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60067-1-Ig targets Neuropilin 1/CD304 in WB, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, pig, rabbit samples.
| Tested Reactivity | human, pig, rabbit |
| Cited Reactivity | human, mouse, rabbit, xenopus |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0931 Product name: Recombinant human NRP1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-300 aa of BC007737 Sequence: MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTN Predict reactive species |
| Full Name | neuropilin 1 |
| Calculated Molecular Weight | 103 kDa |
| Observed Molecular Weight | 130 kDa |
| GenBank Accession Number | BC007737 |
| Gene Symbol | Neuropilin 1 |
| Gene ID (NCBI) | 8829 |
| RRID | AB_2150840 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | O14786 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Neuropilin-1 (NRP1) is a 130-140 kDa transmembrane glycoprotein expressed by endothelial, dendritic, and regulatory T cells, as well as several other normal cell types and malignant tumor cells. NRP1 was first identified as a semaphorin (SEMA) receptor, involved in axonal guidance in embryonic development. NRP1 was also shown to act as a receptor for vascular endothelial growth factor (VEGF) and a promoter of angiogenesis through its interaction with VEGF-A165 (and other VEGFs) and the receptor tyrosine kinase (RTK) VEGF-R2. NRP1 plays versatile roles in angiogenesis, axon guidance, cell survival, migration, and invasion.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Neuropilin 1/CD304 antibody 60067-1-Ig | Download protocol |
| WB protocol for Neuropilin 1/CD304 antibody 60067-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Neuropilin-1 (NRP1) Antibody, catalog number 60067-1-Ig, has 32 citations. Publications appear in journals including Science, Nature Aging, Cell Reports Medicine, Biomaterials, Journal of Controlled Release, Cell Death & Disease, Acta Biomaterialia, iScience, eLife, and Cancer Biology & Medicine. Research fields span oncology (glioma, breast, renal, colorectal, gastric, prostate, and bladder cancers), SARS-CoV-2 infection, angiogenesis, fibrosis, bone biology, ophthalmology, and cardiovascular development.
| Species | Application | Title |
|---|---|---|
Science SPARK-seq: A high-throughput platform for aptamer discovery and kinetic profiling. | ||
Nat Aging Brain-wide alterations revealed by spatial transcriptomics and proteomics in COVID-19 infection | ||
Cell Rep Med Tumor heterogeneity and tumor-microglia interactions in primary and recurrent IDH1-mutant gliomas | ||
Biomaterials Bispecific fibrous glue synergistically boosts vascular normalization and antitumor immunity for advanced renal carcinoma therapy | ||
J Control Release Tumor-penetrating iRGD facilitates penetration of poly(floxuridine-ketal)-based nanomedicine for enhanced pancreatic cancer therapy | ||
Cancer Biol Med SARS-CoV-2 infection in brain tumors and the association with alterations in the tumor immune microenvironment. |
Reviews
What customers say
Based on the available reviews, 60067-1-Ig has received a 5-star rating from a user who tested it for Western Blot and Immunohistochemistry at a 1:400 dilution (Lot 10003461). The reviewer praised the antibody's performance, highlighting its precise band size and clear visibility, describing the overall experience as excellent and enjoyable to work with.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Mounika (Verified Customer) (12-25-2025) | It was excellent journey with this antibody, enjoyed working with it, precise band size and visibility!
|
