NRL Polyclonal antibody

• 

  WB analysis of Transfected HEK-293 using 17388-1-AP

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 17388-1-AP (NRL Antibody) at dilution of 1:1000 incubated at 4 degree celsius over night.

• 

  IHC staining of human retinoblastoma using 17388-1-AP

  Immunohistochemical analysis of paraffin-embedded human retinoblastoma tissue slide using 17388-1-AP (NRL antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human retinoblastoma using 17388-1-AP

  Immunohistochemical analysis of paraffin-embedded human retinoblastoma tissue slide using 17388-1-AP (NRL antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

NRL Polyclonal Antibody for IHC, ELISA

Cat No. 17388-1-AP

Publications(3)

Reviews (2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

D14S46E, neural retina leucine zipper, NRL, NRL MAF, RP27

---

Tested Applications

• Positive IHC detected in: human retinoblastoma tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 2 publications below

Product Information

17388-1-AP targets NRL in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11277

  Product name: Recombinant human NRL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-237 aa of BC012395

  Sequence: MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL

• Full Name: neural retina leucine zipper
• Calculated Molecular Weight: 237 aa, 26 kDa
• GenBank Accession Number: BC012395
• Gene Symbol: NRL
• Gene ID (NCBI): 4901
• RRID: AB_2878400
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P54845
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Cell Stem Cell; Human brain organoids assemble functionally integrated bilateral optic vesicles.; Authors - Elke Gabriel
mouse	WB	JCI Insight; All-in-one AAV-mediated Nrl gene inactivation rescues retinal degeneration in Pde6a mice; Authors - Zhiquan Liu
human	IF	Nat Protoc; Generation of iPSC-derived human forebrain organoids assembling bilateral eye primordia; Authors - Elke Gabriel

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Zhiquan (Verified Customer) (01-12-2024)

This anti-NRL antibody works well for WB in P30 Mouse retina.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: Mouse retina P30

NRL Antibody Western Blot validation (1:1000 dilution) in Mouse retina P30 (Cat no:17388-1-AP)

FH

Alessandro (Verified Customer) (01-19-2023)

great outcome, no unspecific staining

• Applications: Immunofluorescence