B23/NPM1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• B23/NPM1 Polyclonal antibody (10306-1-AP)

• Featured Product
• KD/KO Validated

B23/NPM1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10306-1-AP

Publications(52)

Host / Isotype

Rabbit / IgG

Reactivity

human, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA

Synonyms

B23, NPM1, NPM, Nucleophosmin, Numatrin

• 

  WB analysis using 10306-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10306-1-AP (B23/NPM1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of multi-cells using 10306-1-AP

  WB result of anti-NPM1 (10306-1-AP) in different cell lysates.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10306-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10306-1-AP (B23/NPM1 antibody) at dilution of 1:50000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of C6 using 10306-1-AP

  C6 cells were subjected to SDS PAGE followed by western blot with 10306-1-AP (B23 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of K-562 using 10306-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 10306-1-AP (NPM1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of Jurkat using 10306-1-AP

  IP result of anti-B23/NPM1 (IP:10306-1-AP, 4ug; Detection:10306-1-AP 1:2000) with Jurkat cells lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10306-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10306-1-AP (B23/NPM1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10306-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 10306-1-AP (B23/NPM1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 10306-1-AP

  Immunohistochemical analysis of paraffin-embedded normal colon slide using 10306-1-AP (B23/NPM1 antibody) at dilution of 1:10000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10306-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10306-1-AP (NPM1 antibody) at dilution of 1:100 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 10306-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 10306-1-AP (NPM1 antibody) at dilution of 1:100 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10306-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10306-1-AP (NPM1 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon cancer using 10306-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon cancer using 10306-1-AP (NPM1 antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 10306-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using B23/NPM1 antibody (10306-1-AP) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), Alpha Tubulin antibody (66031-1-Ig, Clone: 1E4C11, red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: COLO 320 cells, Jurkat cells, multi-cells, K-562 cells, HeLa cells, HEK-293 cells
• Positive IP detected in: Jurkat cells
• Positive IHC detected in: human colon cancer tissue, human breast cancer tissue, human normal colon; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:20000-1:100000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10306-1-AP targets B23/NPM1 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0286

  Product name: Recombinant human B23 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-293 aa of BC002398

  Sequence: MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKS

• Full Name: nucleophosmin (nucleolar phosphoprotein B23, numatrin)
• Calculated Molecular Weight: 33 kDa
• Observed Molecular Weight: 35-40 kDa
• GenBank Accession Number: BC002398
• Gene Symbol: NPM1
• Gene ID (NCBI): 4869
• RRID: AB_2155163
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P06748
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Nucleophosmin (NPM1,B23) is a putative ribosome assembly factor with a high affinity for peptides containing nuclear localization signals (NLSs). The transport of proteins across the nuclear envelope is a selective, multistep process involving several cytoplasmic factors. Proteins must be recognized as import substrates, dock at the nuclear pore complex and translocate across the nuclear envelope in an ATP-dependent fashion. Several cytosolic and nuclear proteins that are central to this process have been identified. The 38 kDa nuclear protein nucleophosmin is involved in ribosomal assembly and rRNA transport. It is an abundant protein that is highly phosphorylated by Cdc2 kinase during mitosis. NPM1 can interact with multiple proteins to form complexes, so the detected molecular weight may sometimes increase.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IP	Signal Transduct Target Ther; Global profiling of O-GlcNAcylated and/or phosphorylated proteins in hepatoblastoma.; Authors - Hang Song
mouse	IHC	Nature; Divergent transcriptional regulation of astrocyte reactivity across disorders.; Authors - Joshua E Burda
human	IF	Nat Immunol; Nucleophosmin 1 promotes mucosal immunity by supporting mitochondrial oxidative phosphorylation and ILC3 activity; Authors - Rongchuan Zhao
mouse	WB	Nat Cell Biol; Cyclophilin A supports translation of intrinsically disordered proteins and affects haematopoietic stem cell ageing; Authors - Laure Maneix
human	chIP	Cancer Res; LNMICC promotes nodal metastasis of cervical cancer by reprogramming fatty acid metabolism.; Authors - Chunliang Shang
human	WB,IF	Nat Commun; ASO therapy rescues NOTCH2NLC GGC repeat expansion-induced genomic damage, 3D chromatin structural abnormalities, and senescence.; Authors - Mengjie Li