NKX2-5 Polyclonal antibody

• 

  WB analysis of human heart using 13921-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 13921-1-AP (NKX2-5 antibody) at dilution of 1:1200 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human heart using 13921-1-AP

  human heart tissue were subjected to SDS PAGE followed by western blot with 13921-1-AP (NKX2-5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human brain using 13921-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13921-1-AP (NKX2-5 antibody) at dilution of 1:100 (under 40x lens).

• 

  IHC staining of mouse heart using 13921-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13921-1-AP (NKX2-5 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 13921-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 13921-1-AP (NKX2-5 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human brain using 13921-1-AP

  Immunohistochemical analysis of paraffin-embedded human brain using 13921-1-AP (NKX2-5 antibody) at dilution of 1:100 (under 10x lens).

• 

  IF Staining of mouse embryo using 13921-1-AP

  Immunofluorescent analysis of (4% PFA) fixed mouse embryo tissue using NKX2-5 antibody (13921-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

NKX2-5 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 13921-1-AP

Publications(13)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

NKX25, Homeobox protein Nkx-2.5, Homeobox protein Nkx 2.5, Homeobox protein NK-2 homolog E, CSX

---

Tested Applications

• Positive WB detected in: human heart tissue
• Positive IHC detected in: human brain tissue, mouse heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse embryo tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:3000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 10 publications below
• IF: See 3 publications below

Product Information

13921-1-AP targets NKX2-5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4930

  Product name: Recombinant human NKX2-5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-324 aa of BC025711

  Sequence: MFPSPALTPTPFSVKDILNLEQQQRSLAAAGELSARLEATLAPSSCMLAAFKPEAYAGPEAAAPGLPELRAELGRAPSPAKCASAFPAAPAFYPRAYSDPDPAKDPRAEKKELCALQKAVELEKTEADNAERPRARRRRKPRVLFSQAQVYELERRFKQQRYLSAPERDQLASVLKLTSTQVKIWFQNRRYKCKRQRQDQTLELVGLPPPPPPPARRIAVPVLVRDGKPCLGDSAPYAPAYGVGLNPYGYNAYPAYPGYGGAACSPGYSCTAAYPAGPSPAQPATAAANNNFVNFGVGDLNAVQSPGIPQSNSGVSTLHGIRAW

• Full Name: NK2 transcription factor related, locus 5 (Drosophila)
• Calculated Molecular Weight: 324 aa, 35 kDa
• Observed Molecular Weight: 30-42 kda
• GenBank Accession Number: BC025711
• Gene Symbol: NKX2-5
• Gene ID (NCBI): 1482
• RRID: AB_1851479
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P52952
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Homeobox-containing genes play critical roles in regulating tissue-specific gene expression essential for tissue differentiation, as well as determining the temporal and spatial patterns of development [PMID: 7665173]. NKX2-5 encoded by homeobox-containing genes that implicated in commitment to and/or differentiation of the myocardial lineage, and acts as a transcriptional activator of ANF in cooperation with GATA4. During embryonic development, NKX2-5 plays pivotal roles in specifying cardiac progenitors, cardiac morphogenesis, cardiomyocyte differentiation and conduction system development [PMID: 22824467].

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Rep; Post-transcriptional Regulation of Nkx2-5 by RHAU in Heart Development.; Authors - Junwei Nie
human	IF	iScience; A dual SHOX2:GFP; MYH6:mCherry knockin hESC reporter line for derivation of human SAN-like cells.; Authors - Zaniar Ghazizadeh
rat	WB	Am J Physiol Heart Circ Physiol; Homocysteine downregulates cardiac homeobox transcription factor NKX2.5 via IGFBP5.; Authors - Guangrui Lai
mouse	WB	J Appl Toxicol; The effect of maternal exposure to di-(2-ethylhexyl)-phthalate on fetal cardiac development in mice.; Authors - Changqing Tang
rat	WB	Mol Med Rep; H3K9me2 regulates early transcription factors to promote mesenchymal stem‑cell differentiation into cardiomyocytes.; Authors - Xiaolin Sun
rat	IF	Int J Clin Exp Pathol; SDF-1α promotes repair of myocardial ischemic necrosis zones in rats.; Authors - Xinhua Cai

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Rebecca (Verified Customer) (10-25-2022)

20ug of protein were loaded. Transference was performed at 4ºC and 90V for 2h. Antibody incubation was done ON at 4ºC.

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: iPSC-CM

NKX2-5 Antibody Western Blot validation (1:1000 dilution) in iPSC-CM (Cat no:13921-1-AP)