Tested Applications
| Positive WB detected in | HEK-293 cells, HepG2 cells |
| Positive IP detected in | HEK-293 cells |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 2 publications below |
Product Information
10174-1-AP targets NKIRAS2 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0221 Product name: Recombinant human NKIRAS2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-191 aa of BC007450 Sequence: MGKSCKVVVCGQASVGKTSILEQLLYGNHVVGSEMIETQEDIYVGSIETDRGVREQVRFYDTRGLRDGAELPRHCFSCTDGYVLVYSTDSRESFQRVELLKKEIDKSKDKKEVTIVVLGNKCDLQEQRRVDPDVAQHWAKSEKVKLWEVSVADRRSLLEPFVYLASKMTQPQSKSAFPLSRKNKGSGSLDG Predict reactive species |
| Full Name | NFKB inhibitor interacting Ras-like 2 |
| Calculated Molecular Weight | 22 kDa |
| Observed Molecular Weight | 22 kDa |
| GenBank Accession Number | BC007450 |
| Gene Symbol | NKIRAS2 |
| Gene ID (NCBI) | 28511 |
| RRID | AB_2298444 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NYR9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
I-Kappa-B-interacting Ras-like protein 2 (KBRAS2, MGC:4553), interact with the PEST domains of IkappaBalpha and IkappaBbeta [inhibitors of the transcription factor nuclear factor kappa B (NF-kappaB)] and decrease their rate of degradation. KBRAS2 differs from other Ras proteins in containing Ala and Leu residues at positions 12 and 61 respectively, which are similar to those present in the oncogenic forms of Ras.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for NKIRAS2 antibody 10174-1-AP | Download protocol |
| IP protocol for NKIRAS2 antibody 10174-1-AP | Download protocol |
| WB protocol for NKIRAS2 antibody 10174-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun κB-Ras and Ral GTPases regulate acinar to ductal metaplasia during pancreatic adenocarcinoma development and pancreatitis. | ||
Nat Commun Characterization of dsRNA binding proteins through solubility analysis identifies ZNF385A as a dsRNA homeostasis regulator |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Rebecca (Verified Customer) (06-13-2025) | The antibody works very well for western blot. I used it at 1:1000 dilution in 3% BSA in TBST (overnight incubation).
![]() |
FH Andrea (Verified Customer) (09-18-2020) | The antibody works great in Western Blot. Good signal and specificity, which was tested on knockout cells.
|








