NEDD1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• NEDD1 Polyclonal antibody (13993-1-AP)

NEDD1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13993-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, IP, ELISA

Synonyms

NEDD 1, NEDD-1, Neural precursor cell expressed developmentally down-regulated protein 1, Protein NEDD1

• 

  WB analysis using 13993-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 13993-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of SH-SY5Y using 13993-1-AP

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 13993-1-AP (NEDD1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 13993-1-AP

  IP result of anti-NEDD1 (IP:13993-1-AP, 3ug; Detection:13993-1-AP 1:800) with HeLa cells lysate 2150ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat small intestine using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 13993-1-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 13993-1-AP (NEDD1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for NEDD1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, human brain tissue, SH-SY5Y cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver tissue, human placenta tissue, rat small intestine tissue, human colon tissue, mouse stomach tissue, human stomach cancer tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

13993-1-AP targets NEDD1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5077

  Product name: Recombinant human NEDD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-332 aa of BC027605

  Sequence: MQENLRFASSGDDIKIWDASSMTLVDKFNPHTSPHGISSICWSSNNNFLVTASSSGDKIVVSSCKCKPVPLLELAEGQKQTCVNLNSTSMYLVSGGLNNTVNIWDLKSKRVHRSLKDHKDQVTCVTYNWNDCYIASGSLSGEIILHSVTTNLSSTPFGHGSNQSVRHLKYSLFKKSLLGSVSDNGIVTLWDVNSQSPYHNFDSVHKAPASGICFSPVNELLFVTIGLDKRIILYDTSSKKLVKTLVADTPLTAVDFMPDGATLAIGSSRGKIYQYDLRMLKSPVKTISAHKTSVQCIAFQYSTVLTKSSLNKGCSNKPTTVNKRSVNVNAAS

• Full Name: neural precursor cell expressed, developmentally down-regulated 1
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 75 kDa, 62 kDa
• GenBank Accession Number: BC027605
• Gene Symbol: NEDD1
• Gene ID (NCBI): 121441
• RRID: AB_2149202
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NHV4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

NEDD1 is required for mitosis progression. NEDD1 promotes the nucleation of microtubules from the spindle. This antibody works well in WB, IHC, IP and IF application.

Publications

What published studies show

NEDD1 Antibody (Cat# 13993-1-AP) has 4 total citations published in Science, Cell Reports, Scientific Reports, and Journal of Cancer. The associated research fields span cell biology (acentrosomal spindle assembly, chromosome congression) and oncology (hepatocellular carcinoma, lung adenocarcinoma). Applications include immunofluorescence, Western blot, and immunohistochemistry.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Science; The mechanism of acentrosomal spindle assembly in human oocytes; Authors - Tianyu Wu
	WB	Cell Rep; KIF18A promotes chromosome congression in cooperation with CENP-E downstream of CENP-C.; Authors - Jiahang Miao
human	WB	Sci Rep; Multi-omics analysis of NEDD1 in hepatocellular carcinoma: biological function, prognostic value, and clinical significance.; Authors - Yu Chen ; KD Validated
human	WB,IHC	J Cancer; NEDD1 Promotes the Development of Lung Adenocarcinoma and Can be Used as a Prognostic Marker; Authors - Zhen Yang ; KD Validated