APPBP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• APPBP1 Polyclonal antibody (14863-1-AP)

• Featured Product
• KD/KO Validated

APPBP1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 14863-1-AP Copied!

Publications (4)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

NAE1, Amyloid beta precursor protein-binding protein 1, 59 kDa, Amyloid protein-binding protein 1, APP BP1, APP-BP1

• 

  WB analysis of human kidney using 14863-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 14863-1-AP (APPBP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 14863-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 14863-1-AP (APPBP1 antibody at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of human brain using 14863-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 14863-1-AP (APPBP1 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse kidney using 14863-1-AP

  IP result of anti-APPBP1 (IP:14863-1-AP, 4ug; Detection:14863-1-AP 1:500) with mouse kidney tissue lysate 4000ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse salivary gland using 14863-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse salivary gland tissue slide using 14863-1-AP (APPBP1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for APPBP1 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: human kidney tissue, human brain tissue, mouse brain tissue
• Positive IP detected in: mouse kidney tissue
• Positive IHC detected in: mouse salivary gland tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2400
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

14863-1-AP targets APPBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6672

  Product name: Recombinant human NAE1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 181-534 aa of BC000480

  Sequence: EDLRLDKPFPELREHFQSYDLDHMEKKDHSHTPWIVIIAKYLAQWYSETNGRIPKTYKEKEDFRDLIRQGILKNENGAPEDEENFEEAIKNVNTALNTTQIPSSIEDIFNDDRCINITKQTPSFWILARALKEFVAKEGQGNLPVRGTIPDMIADSGKYIKLQNVYREKAKKDAAAVGNHVAKLLQSIGQAPESISEKELKLLCSNSAFLRVVRCRSLAEEYGLDTINKDEIISSMDNPDNEIVLYLMLRAVDRFHKQQGRYPGVSNYQVEEDIGKLKSCLTGFLQEYGLSVMVKDDYVHEFCRYGAAEPHTIAAFLGGAAAQEVIKIITKQFVIFNNTYIYSGMSQTSATFQL

• Full Name: NEDD8 activating enzyme E1 subunit 1
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC000480
• Gene Symbol: NAE1/APPBP1
• Gene ID (NCBI): 8883
• RRID: AB_2251388
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13564
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The APPBP1 (NAE1) Polyclonal antibody (Cat# 14863-1-AP) has 4 total citations, published in Autophagy, Proceedings of the National Academy of Sciences (PNAS), Apoptosis, and Heliyon. Research fields span osteoclastogenesis and ferroptosis regulation, polo-like kinase-mediated cell survival in mitochondrial dysfunction, neddylated protein profiling in hepatocellular carcinoma prognosis, and NAE1's dual role in nasopharyngeal carcinoma involving antitumor effects and radiotherapy resistance.

Automatically generated from the 4 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
		Autophagy; Targeting NAE1 suppresses osteoclastogenesis via dual regulation of ferritinophagy and ACSL3-mediated ferroptosis.; Authors - Hongwei Xie
	WB	Proc Natl Acad Sci U S A; Polo-like kinases mediate cell survival in mitochondrial dysfunction.; Authors - Takumi Matsumoto ; KD Validated
human	WB	Apoptosis; Identifying Neddylation-modified features to assess prognosis and immune efficacy in hepatocellular carcinoma.; Authors - Zitao Liu
human	IHC	Heliyon; Dual role of targeting NAE1 in nasopharyngeal carcinoma: Antitumor effects yet inducing radiotherapy resistance; Authors - Qinsong Liu