MYH10 Recombinant monoclonal antibody, PBS Only

MYH10 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 86157-3-PBS
Clone No.250791D5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Myosin 10, Myosin heavy chain 10, Myosin heavy chain, non-muscle IIb, Myosin-10, NMMHC II-b

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86157-3-PBS targets MYH10 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag16113

Product name: Recombinant human MYH10 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1183-1322 aa of BC150634

Sequence: QEVAELKKALEEETKNHEAQIQDMRQRHATALEELSEQLEQAKRFKANLEKNKQGLETDNKELACEVKVLQQVKAESEHKRKKLDAQVQELHAKVSEGDRLRVELAEKASKLQNELDNVSTLLEEAEKKGIKFAKDAASL

Predict reactive species
Full Name myosin, heavy chain 10, non-muscle
Calculated Molecular Weight 1985 aa, 230 kDa
Observed Molecular Weight 229 kDa
GenBank Accession NumberBC150634
Gene Symbol MYH10
Gene ID (NCBI) 4628
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP35580
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

MYH10 (non-muscle II-b, NM IIB) is a member of non-muscle myosin II which plays fundamental roles in the maintenance of cell morphology, cell adhesion, and migration, as well as cell division. MYH10 is mainly present in nerve cells, megakaryocytes, and other non-muscle cells. It has been reported to mediate centrosome reorientation during cell migration and contribute to ciliogenesis. Overexpression of MYH10 has been observed in breast cancer.

Loading...