Tested Applications
| Positive WB detected in | mouse skeletal muscle tissue |
| Positive IHC detected in | mouse skeletal muscle tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | C2C12 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| ChIP | See 1 publications below |
Product Information
11754-1-AP targets MYF6 in WB, IHC, IF/ICC, chip, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2350 Product name: Recombinant human MYF6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-242 aa of BC017834 Sequence: MMMDLFETGSYFFYLDGENVTLQPLEVAEGSPLYPGSDGTLSPCQDQMPPEAGSDSSGEEHVLAPPGLQPPHCPGQCLIWACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFLRTCSSQWPSVSDHSRGLVITAKEGGASIDSSASSSLRCLSSIVDSISSEERKLPCVEEVVEK Predict reactive species |
| Full Name | myogenic factor 6 (herculin) |
| Calculated Molecular Weight | 242 aa, 27 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC017834 |
| Gene Symbol | MYF6 |
| Gene ID (NCBI) | 4618 |
| RRID | AB_2250929 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P23409 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for MYF6 antibody 11754-1-AP | Download protocol |
| IHC protocol for MYF6 antibody 11754-1-AP | Download protocol |
| WB protocol for MYF6 antibody 11754-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun MRF4 negatively regulates adult skeletal muscle growth by repressing MEF2 activity. | ||
Front Cell Dev Biol A Functional SNP in the Promoter of LBX1 Is Associated With the Development of Adolescent Idiopathic Scoliosis Through Involvement in the Myogenesis of Paraspinal Muscles. | ||
In Vitro Cell Dev Biol Anim Expression patterns and correlation analyses of muscle-specific genes in the process of sheep myoblast differentiation | ||
Heliyon Exogenous hydrogen sulfide enhances myogenic differentiation of C2C12 myoblasts under high palmitate stress | ||
Stem Cells Int Noggin Combined With Human Dental Pulp Stem Cells to Promote Skeletal Muscle Regeneration |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Kenzo (Verified Customer) (11-11-2023) | Worked well for frozen mouse heart tissue sections.
|







