MPC1 Polyclonal antibody

• 

  WB analysis using 30868-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30868-1-AP (BRP44L antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

MPC1 Polyclonal Antibody for WB, ELISA

Cat No. 30868-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

BRP44L, PNAS 115, HSPC040, CGI 129, Brain protein 44 like protein

---

Tested Applications

• Positive WB detected in: HL-60 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30868-1-AP targets MPC1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag28826

  Product name: Recombinant human BRP44L protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-109 aa of BC000810

  Sequence: MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHATNEVAQLIQGGRLIKHEMTKTASA

• Full Name: brain protein 44-like
• Calculated Molecular Weight: 12 kDa
• Observed Molecular Weight: 12 kDa, 20-24 kDa
• GenBank Accession Number: BC000810
• Gene Symbol: BRP44L
• Gene ID (NCBI): 51660
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y5U8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MPC1, also known as BRP44L. BRP44L is predicted to be located in Mitochondrion inner membrane. The protein forms a heterodimer with MPC2, and the heterodimer is a more stable and dominant form (PMID:26253029, PMID:32403431). Mpc1 and Mpc2 associate to form an ~150-kilodalton complex in the inner mitochondrial membrane. Yeast and Drosophila mutants lacking MPC1 display impaired pyruvate metabolism, with an accumulation of upstream metabolites and a depletion of tricarboxylic acid cycle intermediates. Loss of yeast Mpc1 results in defective mitochondrial pyruvate uptake, and silencing of MPC1 or MPC2 in mammalian cells impairs pyruvate oxidation. A point mutation in MPC1 provides resistance to a known inhibitor of the mitochondrial pyruvate carrier (PMID: 22628558).The molecular weight of MPC1 is 12 kDa.