MOG Polyclonal antibody, PBS Only

• 

  WB analysis using 28752-1-AP (same clone as 28752-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 28752-1-AP (MOG antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 28752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 28752-1-AP (same clone as 28752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 28752-1-AP (MOG antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28752-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 28752-1-AP (same clone as 28752-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 28752-1-AP (MOG antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28752-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse cerebellum using 28752-1-AP (same clone as 28752-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse cerebellum tissue using MOG antibody (28752-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28752-1-PBS in a different storage buffer formulation.

• 

  IF Staining of rat cerebellum using 28752-1-AP (same clone as 28752-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat cerebellum tissue using MOG antibody (28752-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 28752-1-PBS in a different storage buffer formulation.

MOG Polyclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 28752-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

MOGIG 2, Myelin-oligodendrocyte glycoprotein

---

Product Information

28752-1-PBS targets MOG in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30377

  Product name: Recombinant human MOG protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 30-154 aa of BC035938

  Sequence: GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG

• Full Name: myelin oligodendrocyte glycoprotein
• Calculated Molecular Weight: 295 aa, 34 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC035938
• Gene Symbol: MOG
• Gene ID (NCBI): 4340
• RRID: AB_2881208
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q16653
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.