MMP14 / MT1-MMP Polyclonal antibody

MMP14 / MT1-MMP Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 29111-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

Human, mouse and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Matrix metalloproteinase 14, MMP 14, MMP X1, MMP14, MT MMP 1, MT1 MMP, MT1MMP, MTMMP1

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells
Positive IHC detected inhuman colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA549 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

29111-1-AP targets MMP14 / MT1-MMP in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse samples.

Tested Reactivity Human, mouse
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag30755

Product name: Recombinant human MMP14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 356-475 aa of BC064803

Sequence: PIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFT

Predict reactive species
Full Name matrix metallopeptidase 14 (membrane-inserted)
Calculated Molecular Weight 66 kDa
Observed Molecular Weight66-70 kDa
GenBank Accession NumberBC064803
Gene Symbol MMP14
Gene ID (NCBI) 4323
RRIDAB_2918236
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP50281
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP14, also named as MT1-MMP, is a key matrix metalloproteinase (MMP) family member which plays a crucial role in tumor growth, invasion and metastasis. MT1-MMP is a cell membrane-bound proteinase, and it enhances degradation of collagen IV, a major component of the basement membrane, by forming a complex with tissue inhibitor of metalloproteinase-2 (TIMP-2) to activate pro-MMP-2. MT1-MMP can influence venous invasion, intrahepatic metastasis , and patient outcome in hepatocellular carcinoma (HCC). MT1-MMP was reported to be present in centromere and could lead to chromosome instability in MDCK cells, indicating that MT1-MMP may have more novel functions in the intracellular compartments. In western blotting, pro-MMP14 (65 kDa) and MMP14 (51 kDa) bands showed with the truncated MMP14 (45, 42, 35, 20 kDa) forms (PMID:12097451).

Protocols

Product Specific Protocols
WB protocol for MMP14 / MT1-MMP antibody 29111-1-APDownload protocol
IHC protocol for MMP14 / MT1-MMP antibody 29111-1-APDownload protocol
IF protocol for MMP14 / MT1-MMP antibody 29111-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
human,mouseWB

Bioact Mater

Biomimetic nanoparticles drive the mechanism understanding of shear-wave elasticity stiffness in triple negative breast cancers to predict clinical treatment

Authors - Dongdong Zheng
human,mouseWB

Appl Biochem Biotechnol

Kunzea Ericoides (Kanuka) Leaf Extracts Show Moisturisation, Antioxidant, and UV Protection Effects in HaCaT Cells and Anti-melanogenesis Effects in B16F10 Cells

Authors - Xuefeng He
humanWB,IHC

Cancer Lett

Distinct Immunophenotypic Profiles and Neutrophil Heterogeneity in Colorectal Cancer

Authors - Minghua Bai
humanWB,IF

Front Oncol

Overexpression of MMP14 is associated with poor prognosis and immune cell infiltration in colon cancer

Authors - Na Li
mouseWB

JCI Insight

LRP1 regulates asthmatic airway smooth muscle proliferation through FGF2/ERK signaling

Authors - Ya Deng
Loading...