Tested Applications
| Positive WB detected in | mouse brain tissue, rat brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 17 publications below |
| IHC | See 13 publications below |
| IF | See 10 publications below |
Product Information
22989-1-AP targets MMP12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rabbit, hamster |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19068 Product name: Recombinant human MMP12 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 231-402 aa of BC112301 Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR Predict reactive species |
| Full Name | matrix metallopeptidase 12 (macrophage elastase) |
| Calculated Molecular Weight | 470 aa, 54 kDa |
| Observed Molecular Weight | 54 kDa, 45 kDa |
| GenBank Accession Number | BC112301 |
| Gene Symbol | MMP12 |
| Gene ID (NCBI) | 4321 |
| RRID | AB_2879193 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P39900 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
MMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for MMP12 antibody 22989-1-AP | Download protocol |
| WB protocol for MMP12 antibody 22989-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Cell Biol Autophagy enables microglia to engage amyloid plaques and prevents microglial senescence | ||
Nat Commun Lung-derived HMGB1 is detrimental for vascular remodeling of metabolically imbalanced arterial macrophages. | ||
Biomaterials MMP-12 siRNA improves the homeostasis of the small intestine and metabolic dysfunction in high-fat diet feeding-induced obese mice. | ||
J Crohns Colitis Matrix Metalloproteinase MMP-12 promotes macrophage transmigration across intestinal epithelial tight junctions and increases severity of experimental colitis. | ||
Redox Biol Hydrogen sulfide attenuates cigarette smoke-induced airway remodeling by upregulating SIRT1 signaling pathway. | ||
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH A (Verified Customer) (07-15-2025) | Used for caco2 cells and animal colon tissue
|
FH Hongxue (Verified Customer) (01-17-2023) | IHC staining in mouse liver, macrophage specific positive signaling.
![]() |
FH Yadavalli (Verified Customer) (07-20-2021) | I had used the MMP12 antibody and detected in the lung tissue which ad shown a significant data
![]() |
FH Hongxue (Verified Customer) (01-12-2021) | wb band very good
![]() |




