MMP12 Polyclonal antibody

MMP12 Polyclonal Antibody for WB, ELISA
Cat No. 22989-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF, ELISA

EC:3.4.24.65, HME, Macrophage elastase, Macrophage metalloelastase, Matrix metalloproteinase 12

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, rat brain tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:3000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

22989-1-AP targets MMP12 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rabbit, hamster
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag19068

Product name: Recombinant human MMP12 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 231-402 aa of BC112301

Sequence: DPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFFFKDRFFWLKVSERPKTSVNLISSLWPTLPSGIEAAYEIEARNQVFLFKDDKYWLISNLRPEPNYPKSIHSFGFPNFVKKIDAAVFNPRFYRTYFFVDNQYWR

Predict reactive species
Full Name matrix metallopeptidase 12 (macrophage elastase)
Calculated Molecular Weight 470 aa, 54 kDa
Observed Molecular Weight 54 kDa, 45 kDa
GenBank Accession NumberBC112301
Gene Symbol MMP12
Gene ID (NCBI) 4321
RRIDAB_2879193
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP39900
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

MMP12(Matrix metalloproteinase-12) is a 54 kDa proenzyme that is processed into a 45 kDa and then a 22 kDa active form(15723202). MMP9 and MMP12 promote intimal thickening by independent cleavage of N-cadherin, which elevates vascular smooth muscle cell proliferation via beta-catenin signalling. Its overexpression in myeloid lineage cells plays a key role in modulating myelopoiesis, immune suppression, and lung tumorigenesis(PMID: 21378275).

Protocols

Product Specific Protocols
IHC protocol for MMP12 antibody 22989-1-APDownload protocol
WB protocol for MMP12 antibody 22989-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Nat Cell Biol

Autophagy enables microglia to engage amyloid plaques and prevents microglial senescence

Authors - Insup Choi
humanWB,IHC

Nat Commun

Lung-derived HMGB1 is detrimental for vascular remodeling of metabolically imbalanced arterial macrophages.

Authors - Ludovic Boytard
mouse,humanWB,IF

Biomaterials

MMP-12 siRNA improves the homeostasis of the small intestine and metabolic dysfunction in high-fat diet feeding-induced obese mice.

Authors - Mingming Song
mouseWB,IF

J Crohns Colitis

Matrix Metalloproteinase MMP-12 promotes macrophage transmigration across intestinal epithelial tight junctions and increases severity of experimental colitis.

Authors - Meghali Nighot
humanWB

Redox Biol

Hydrogen sulfide attenuates cigarette smoke-induced airway remodeling by upregulating SIRT1 signaling pathway.

Authors - Ruijuan Guan
mouseIHC

Respir Res

Role of PM2.5 in the development and progression of COPD and its mechanisms.

Authors - Junling Zhao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

A (Verified Customer) (07-15-2025)

Used for caco2 cells and animal colon tissue

  • Applications: Western Blot, Immunohistochemistry
  • Primary Antibody Dilution: 1 to 1000
FH

Hongxue (Verified Customer) (01-17-2023)

IHC staining in mouse liver, macrophage specific positive signaling.

  • Applications: Immunohistochemistry
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: Mouse liver
MMP12 Antibody Immunohistochemistry validation (1:500 dilution) in Mouse liver (Cat no:22989-1-AP)
FH

Yadavalli (Verified Customer) (07-20-2021)

I had used the MMP12 antibody and detected in the lung tissue which ad shown a significant data

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Lung
MMP12 Antibody Western Blot validation (1:1000 dilution) in Lung (Cat no:22989-1-AP)
FH

Hongxue (Verified Customer) (01-12-2021)

wb band very good

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: Liver
MMP12 Antibody Western Blot validation (1:1000 dilution) in Liver (Cat no:22989-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...