• Featured Product
  • KD/KO Validated

c-Met (Cytoplasmic) Polyclonal antibody

c-Met (Cytoplasmic) Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 25869-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, canine

Applications

WB, IHC, FC (Intra), IP, CoIP, RIP, ELISA

c-Met, MET, AUTS9, c Met, EC:2.7.10.1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, MDCK cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman lung cancer tissue, human breast cancer tissue, human colon tissue, human liver cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

25869-1-AP targets c-Met (Cytoplasmic) in WB, IHC, FC (Intra), IP, CoIP, RIP, ELISA applications and shows reactivity with human, mouse, rat, canine samples.

Tested Reactivity human, mouse, rat, canine
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag23140

Product name: Recombinant human MET protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 965-1085 aa of BC130420

Sequence: GSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIG

Predict reactive species
Full Name met proto-oncogene (hepatocyte growth factor receptor)
Calculated Molecular Weight 1390 aa, 155 kDa
Observed Molecular Weight 145 kDa
GenBank Accession NumberBC130420
Gene Symbol MET
Gene ID (NCBI) 4233
RRIDAB_2880276
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP08581
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

c-Met (also named MET or HGFR) is a receptor tyrosine kinase that transduces signals from the extracellular matrix into the cytoplasm by binding to the HGF ligand. c-Met regulates many physiological processes including proliferation, scattering, morphogenesis, and survival. The primary single-chain precursor protein is post-translationally cleaved to produce the alpha and beta subunits, which are disulfide-linked to form the mature receptor. Overexpression and/or mutation of c-Met has been reported in various human malignancies, including lung cancer, breast cancer, head and neck cancer, gastric cancer, colorectal cancer, bladder cancer, uterine cervix carcinoma, esophageal carcinoma, c-Met could serve as an important therapeutic target (PMID: 26036285). The c-met receptor is a 190-kD glycoprotein consisting of a 145-kD membrane-spanning beta chain and a 50-kD alpha chain (PMID: 7806559). In Western blot, this antibody produces bands of unknown identity at 55 and 100 kDa.

Protocols

Product Specific Protocols
FC protocol for c-Met (Cytoplasmic) antibody 25869-1-APDownload protocol
IF protocol for c-Met (Cytoplasmic) antibody 25869-1-APDownload protocol
IHC protocol for c-Met (Cytoplasmic) antibody 25869-1-APDownload protocol
IP protocol for c-Met (Cytoplasmic) antibody 25869-1-APDownload protocol
WB protocol for c-Met (Cytoplasmic) antibody 25869-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Nat Metab

LIFR regulates cholesterol-driven bidirectional hepatocyte-neutrophil cross-talk to promote liver regeneration

Authors - Yalan Deng
ratWB

Acta Pharmacol Sin

GPR97 deficiency ameliorates renal interstitial fibrosis in mouse hypertensive nephropathy

Authors - Ji-Chao Wu
mouseWB

Clin Transl Med

Ursodesoxycholic acid alleviates liver fibrosis via proregeneration by activation of the ID1-WNT2/HGF signaling pathway.

Authors - Xi Dong
WB

Oxid Med Cell Longev

PMID: 31781338

Authors - Ya-Dong Liu
humanIHC

Mol Ther Nucleic Acids

miRNA in food simultaneously controls animal viral disease and human tumorigenesis.

Authors - Yalei Cui
humanWB

Mol Ther Nucleic Acids

Shrimp miR-34 from Shrimp Stress Response to Virus Infection Suppresses Tumorigenesis of Breast Cancer.

Authors - Yalei Cui

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marius (Verified Customer) (09-30-2025)

Clear signal at 145 kDa. As depicted in datasheet second signal at around 100 kDa.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:1000
  • Cell Tissue Type: CMT93 cells
Loading...
||
New chat Able
正在加载,请稍候...